Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of COX4I2 expression in transfected 293T cell line by COX4I2 polyclonal antibody. Lane 1: COX4I2 transfected lysate (20kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human COX4I2 Polyclonal Antibody | anti-COX4I2 antibody

COX4I2 (Cytochrome C Oxidase Subunit 4 Isoform 2, Mitochondrial, Cytochrome C Oxidase Subunit IV Isoform 2, COX IV-2, COX4L2) (AP)

Gene Names
COX4I2; COX4; COX4B; COX4-2; COX4L2; COXIV-2; dJ857M17.2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COX4I2; Polyclonal Antibody; COX4I2 (Cytochrome C Oxidase Subunit 4 Isoform 2; Mitochondrial; Cytochrome C Oxidase Subunit IV Isoform 2; COX IV-2; COX4L2) (AP); anti-COX4I2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human COX4I2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-COX4I2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human COX4I2, aa1-171 (NP_115998.2).
Immunogen Sequence
MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of COX4I2 expression in transfected 293T cell line by COX4I2 polyclonal antibody. Lane 1: COX4I2 transfected lysate (20kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of COX4I2 expression in transfected 293T cell line by COX4I2 polyclonal antibody. Lane 1: COX4I2 transfected lysate (20kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-COX4I2 antibody
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation.
Product Categories/Family for anti-COX4I2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,010 Da
NCBI Official Full Name
cytochrome c oxidase subunit 4 isoform 2, mitochondrial
NCBI Official Synonym Full Names
cytochrome c oxidase subunit IV isoform 2 (lung)
NCBI Official Symbol
COX4I2
NCBI Official Synonym Symbols
COX4; COX4B; COX4-2; COX4L2; COXIV-2; dJ857M17.2
NCBI Protein Information
cytochrome c oxidase subunit 4 isoform 2, mitochondrial; COX IV-2; cytochrome c oxidase subunit IV-like 2
UniProt Protein Name
Cytochrome c oxidase subunit 4 isoform 2, mitochondrial
UniProt Gene Name
COX4I2
UniProt Synonym Gene Names
COX4L2; COX IV-2
UniProt Entry Name
COX42_HUMAN

NCBI Description

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq, Jul 2008]

Uniprot Description

COX4I2: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Defects in COX4I2 are the cause of exocrine pancreatic insufficiency dyserythropoietic anemia and calvarial hyperostosis (EPIDACH). Patients present with pancreatic insufficiency, intestinal malabsorption, failure to thrive, and anemia soon after birth. Belongs to the cytochrome c oxidase IV family.

Protein type: Oxidoreductase; Mitochondrial

Chromosomal Location of Human Ortholog: 20q11.21

Cellular Component: mitochondrial respiratory chain complex IV

Molecular Function: cytochrome-c oxidase activity

Biological Process: generation of precursor metabolites and energy; cellular respiration

Disease: Exocrine Pancreatic Insufficiency, Dyserythropoietic Anemia, And Calvarial Hyperostosis

Research Articles on COX4I2

Similar Products

Product Notes

The COX4I2 cox4i2 (Catalog #AAA6374500) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COX4I2 (Cytochrome C Oxidase Subunit 4 Isoform 2, Mitochondrial, Cytochrome C Oxidase Subunit IV Isoform 2, COX IV-2, COX4L2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COX4I2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COX4I2 cox4i2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COX4I2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.