Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human SETD7 Monoclonal Antibody | anti-SETD7 antibody

SETD7 (SET Domain-containing Protein 7, SET7, Histone-lysine N-methyltransferase SETD7, Histone H3-K4 Methyltransferase SETD7, H3-K4-HMTase SETD7, KIAA1717, Lysine N-methyltransferase 7, KMT7, SET7/9, SET9) APC

Gene Names
SETD7; KMT7; SET7; SET9; SET7/9
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SETD7; Monoclonal Antibody; SETD7 (SET Domain-containing Protein 7; SET7; Histone-lysine N-methyltransferase SETD7; Histone H3-K4 Methyltransferase SETD7; H3-K4-HMTase SETD7; KIAA1717; Lysine N-methyltransferase 7; KMT7; SET7/9; SET9) APC; EC=2.1.1.43; anti-SETD7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5B4
Specificity
Recognizes human SET7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SETD7 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa257-367 from human SET7 (NP_085151) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQATQQK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(SET7 monoclonal antibody, Western Blot analysis of SET7 expression in Jurkat.)

Western Blot (WB) (SET7 monoclonal antibody, Western Blot analysis of SET7 expression in Jurkat.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SETD7 on formalin-fixed paraffin-embedded human colon. [antibody concentration 0.5ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SETD7 on formalin-fixed paraffin-embedded human colon. [antibody concentration 0.5ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SET7 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SET7 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-SETD7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,721 Da
NCBI Official Full Name
histone-lysine N-methyltransferase SETD7 isoform 1
NCBI Official Synonym Full Names
SET domain containing lysine methyltransferase 7
NCBI Official Symbol
SETD7
NCBI Official Synonym Symbols
KMT7; SET7; SET9; SET7/9
NCBI Protein Information
histone-lysine N-methyltransferase SETD7
UniProt Protein Name
Histone-lysine N-methyltransferase SETD7
UniProt Gene Name
SETD7
UniProt Synonym Gene Names
KIAA1717; KMT7; SET7; SET9; H3-K4-HMTase SETD7
UniProt Entry Name
SETD7_HUMAN

Uniprot Description

SETD7: Histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes such as collagenase or insulin. Recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. Has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins. Monomethylates 'Lys-189' of TAF10, leading to increase the affinity of TAF10 for RNA polymerase II. Monomethylates 'Lys-372' of p53/TP53, stabilizing p53/TP53 and increasing p53/TP53-mediated transcriptional activation. Interacts with IPF1/PDX-1. Widely expressed. Expressed in pancreatic islets. Belongs to the histone-lysine methyltransferase family. SET7 subfamily.

Protein type: Amino Acid Metabolism - lysine degradation; EC 2.1.1.43; Methyltransferase, protein lysine; Methyltransferase

Chromosomal Location of Human Ortholog: 4q28

Cellular Component: nucleoplasm; nucleolus; chromosome

Molecular Function: protein binding; p53 binding; protein-lysine N-methyltransferase activity; histone-lysine N-methyltransferase activity

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; regulation of transcription, DNA-dependent; peptidyl-lysine di-methylation; peptidyl-lysine mono-methylation; chromatin modification; response to DNA damage stimulus

Research Articles on SETD7

Similar Products

Product Notes

The SETD7 setd7 (Catalog #AAA6138999) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SETD7 (SET Domain-containing Protein 7, SET7, Histone-lysine N-methyltransferase SETD7, Histone H3-K4 Methyltransferase SETD7, H3-K4-HMTase SETD7, KIAA1717, Lysine N-methyltransferase 7, KMT7, SET7/9, SET9) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SETD7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SETD7 setd7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SETD7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.