Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human COVID 19 ORF8 Coronavirus Polyclonal Antibody | anti-COVID-19 antibody

Anti-SARS-CoV-2 ORF8 Antibody

Reactivity
Human
Applications
ELISA
Purity
Immunogen affinity purified.
Synonyms
COVID 19 ORF8 Coronavirus; Polyclonal Antibody; Anti-SARS-CoV-2 ORF8 Antibody; 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; ORF8; anti-COVID-19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Rabbit IgG polyclonal antibody for SARS-CoV-2 ORF8 detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Applicable Applications for anti-COVID-19 antibody
ELISA (EIA)
Application Notes
ELISA: 0.001-0.1ug/ml|Human|
Immunogen
AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Related Product Information for anti-COVID-19 antibody
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined. ~ ORF8 encodes a viral accessory protein.
References
1. Gordon DE, et al. Nature, 2020 Jul.
2. Gordon DE, et al. Science, 2020 Oct 15.
3. Li JY, et al. Virus Res, 2020 Sep.
4. Wu F, et al. Nature, 2020 Mar.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #

Similar Products

Product Notes

The COVID-19 (Catalog #AAA1753855) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SARS-CoV-2 ORF8 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COVID 19 ORF8 Coronavirus can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). ELISA: 0.001-0.1ug/ml|Human|. Researchers should empirically determine the suitability of the COVID-19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COVID 19 ORF8 Coronavirus, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.