Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ADCK3Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit COQ8A Polyclonal Antibody | anti-COQ8A antibody

COQ8A Antibody - C-terminal region

Gene Names
COQ8A; COQ8; ADCK3; ARCA2; CABC1; SCAR9; COQ10D4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COQ8A; Polyclonal Antibody; COQ8A Antibody - C-terminal region; anti-COQ8A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVLCLRELFEFHFMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDL
Sequence Length
492
Applicable Applications for anti-COQ8A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human ADCK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADCK3Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADCK3Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-COQ8A antibody
This is a rabbit polyclonal antibody against ADCK3. It was validated on Western Blot

Target Description: This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined.
Product Categories/Family for anti-COQ8A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
atypical kinase COQ8A, mitochondrial
NCBI Official Synonym Full Names
coenzyme Q8A
NCBI Official Symbol
COQ8A
NCBI Official Synonym Symbols
COQ8; ADCK3; ARCA2; CABC1; SCAR9; COQ10D4
NCBI Protein Information
atypical kinase COQ8A, mitochondrial
UniProt Protein Name
Chaperone activity of bc1 complex-like, mitochondrial
Protein Family
UniProt Gene Name
ADCK3
UniProt Synonym Gene Names
CABC1; Chaperone-ABC1-like
UniProt Entry Name
ADCK3_HUMAN

NCBI Description

This gene encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

ADCK3: May be a chaperone-like protein essential for the proper conformation and functioning of protein complexes in the respiratory chain. Defects in ADCK3 are the cause of coenzyme Q10 deficiency, primary, type 4 (COQ10D4). An autosomal recessive disorder characterized by childhood-onset of cerebellar ataxia and exercise intolerance. Patient manifest gait ataxia and cerebellar atrophy with slow progression. Additional features include brisk tendon reflexes and Hoffmann sign, variable psychomotor retardation and variable seizures. Belongs to the protein kinase superfamily. ADCK protein kinase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.11.-; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, atypical; ATYPICAL group; ABC1 family; ABC1-A subfamily

Chromosomal Location of Human Ortholog: 1q42.13

Cellular Component: mitochondrion

Molecular Function: protein serine/threonine kinase activity; ATP binding

Biological Process: ubiquinone biosynthetic process; protein amino acid phosphorylation

Disease: Coenzyme Q10 Deficiency, Primary, 4

Research Articles on COQ8A

Similar Products

Product Notes

The COQ8A adck3 (Catalog #AAA3208990) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COQ8A Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's COQ8A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COQ8A adck3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVLCLRELFE FHFMQTDPNW SNFFYDPQQH KVALLDFGAT REYDRSFTDL. It is sometimes possible for the material contained within the vial of "COQ8A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.