Mouse anti-Human Connexin 30.3 Polyclonal Antibody | anti-Gjb4 antibody

Connexin 30.3 (Gap Junction beta-4 Protein, Connexin-30.3, Cx30.3, GJB4)

Cat. Num. AAA648893

• Gene Names: Gjb4; Gjb-4; Cx30.3; Cnx30.3
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: Connexin 30.3; Polyclonal Antibody; Connexin 30.3 (Gap Junction beta-4 Protein; Connexin-30.3; Cx30.3; GJB4); Anti -Connexin 30.3 (Gap Junction beta-4 Protein; anti-Gjb4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GJB4.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGCPNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRPTEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLSQGGHPEDGNSVLMKAGSAPVDAGGYP

• Applicable Applications for anti-Gjb4 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human GJB4, aa1-266 (NP_694944.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GJB4 expression in transfected 293T cell line by GJB4 polyclonal antibody. Lane 1: GJB4 transfected lysate (30.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-Gjb4 antibody

Gap junctions permit direct cell-to-cell passage of small cytoplasmic molecules, including ions, metabolic intermediates, and second messengers, and thereby mediate intercellular communication. Gap junction channels consist of connexin protein subunits encoded by a multigene family. Erythrokeratodermia variabilis (EKV) is an autosomal dominant disorder of keratinization characterized by migratory erythematous lesions and fixed keratotic plaques. Mutations in the GJB3 gene have been reported in some but not all families, although it has been postulated that the absence of connexin 30.3 can be compensated by other connexins.

Product Categories/Family for anti-Gjb4 antibody

Antibodies; Abs to Connexin; Junction Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 192647
• NCBI GeneID: 14621
• UniProt Accession #: Q02738
• Molecular Weight: 30,389 Da
• NCBI Official Full Name: connexin 30.3
• NCBI Official Synonym Full Names: gap junction protein, beta 4
• NCBI Official Symbol: Gjb4
• NCBI Official Synonym Symbols: Gjb-4; Cx30.3; Cnx30.3
• NCBI Protein Information: gap junction beta-4 protein; connexin-30.3; gap junction membrane channel protein beta 4
• UniProt Protein Name: Gap junction beta-4 protein
• Protein Family: Gap junction beta-4 protein
• UniProt Gene Name: Gjb4
• UniProt Synonym Gene Names: Cxn-30.3; Cx30.3
• UniProt Entry Name: CXB4_MOUSE

Uniprot Description

Function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Subunit structure: A connexon is composed of a hexamer of connexins.

Subcellular location: Cell membrane; Multi-pass membrane protein. Cell junction › gap junction.

Tissue specificity: Expressed in skin.

Sequence similarities: Belongs to the connexin family. Beta-type (group I) subfamily.