Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CFI expression in transfected 293T cell line by 125208. Lane 1: CFI transfected lysate (42.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Complement Factor I Polyclonal Antibody | anti-CFI antibody

Complement Factor I (C3B/C4B Inactivator, CFI, IF) (MaxLight 405)

Gene Names
CFI; FI; IF; KAF; AHUS3; ARMD13; C3BINA; C3b-INA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Complement Factor I; Polyclonal Antibody; Complement Factor I (C3B/C4B Inactivator; CFI; IF) (MaxLight 405); anti-CFI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human Complement Factor I.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
1249
Applicable Applications for anti-CFI antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length protein corresponding to aa1-377 from human Complement Factor I.
Immunogen Sequence
MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCVCKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTECLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVAQEETEILTADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGKMKQISLDIFKGLHRVYAILEFCCIILK
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CFI expression in transfected 293T cell line by 125208. Lane 1: CFI transfected lysate (42.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CFI expression in transfected 293T cell line by 125208. Lane 1: CFI transfected lysate (42.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CFI antibody
Complement Factor I is a member of the peptidase S1 family present in the blood plasma. Factor I is an 88kD protein consisting of one polypeptide chain of 35.4kD and one of 27.6kD. Factor I is a serine protease which inactivates complement components C3b and C4b. C3b cleavage requires the presence of cofactors complement component (3b/4b) receptor 1 (CR1), membrane cofactor protein or factor H, while C4b cleavage requires complement component 4 binding protein or CR1. Factor I has no natural inhibitors. Dysfunctional factor I can lead to uncontrolled activation of the alternative complement pathway causing systemic depletion of C3 and lowering levels of factors B and H, resulting in recurrent pyogenic infections. Defects in CFI are also associated with haemolytic uraemic syndrome.
Product Categories/Family for anti-CFI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens complement factor I, mRNA
NCBI Official Synonym Full Names
complement factor I
NCBI Official Symbol
CFI
NCBI Official Synonym Symbols
FI; IF; KAF; AHUS3; ARMD13; C3BINA; C3b-INA
NCBI Protein Information
complement factor I
Protein Family

NCBI Description

This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uremic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immune deposits and age-related macular degeneration are other conditions associated with mutations of this gene. [provided by RefSeq, Dec 2015]

Research Articles on CFI

Similar Products

Product Notes

The CFI (Catalog #AAA6374406) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Complement Factor I (C3B/C4B Inactivator, CFI, IF) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Complement Factor I can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CFI for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Complement Factor I, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.