Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Rat Collagen XVII/COL17A1 Polyclonal Antibody | anti-COL17A1 antibody

Collagen XVII/COL17A1 Rabbit pAb

Gene Names
COL17A1; BP180; BPA-2; BPAG2; LAD-1; BA16H23.2
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
Collagen XVII/COL17A1; Polyclonal Antibody; Collagen XVII/COL17A1 Rabbit pAb; COL17A1; BA16H23.2; BP180; BPA-2; BPAG2; ERED; LAD-1; collagen alpha-1(XVII) chain; EBR2A; JEB-I; anti-COL17A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
SVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGP
Applicable Applications for anti-COL17A1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human Collagen XVII/Collagen XVII/COL17A1 (NP_000485.3).
Cellular Location
Cell junction, Membrane, Secreted, Single-pass type II membrane protein, basement membrane, extracellular matrix, extracellular space, hemidesmosome
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-COL17A1 antibody
Background: This gene encodes the alpha chain of type XVII collagen. Unlike most collagens, collagen XVII is a transmembrane protein. Collagen XVII is a structural component of hemidesmosomes, multiprotein complexes at the dermal-epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. Mutations in this gene are associated with both generalized atrophic benign and junctional epidermolysis bullosa. Two homotrimeric forms of type XVII collagen exist. The full length form is the transmembrane protein. A soluble form, referred to as either ectodomain or LAD-1, is generated by proteolytic processing of the full length form.
Product Categories/Family for anti-COL17A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
150,419 Da
NCBI Official Full Name
collagen alpha-1(XVII) chain
NCBI Official Synonym Full Names
collagen, type XVII, alpha 1
NCBI Official Symbol
COL17A1
NCBI Official Synonym Symbols
BP180; BPA-2; BPAG2; LAD-1; BA16H23.2
NCBI Protein Information
collagen alpha-1(XVII) chain; collagen alpha-1(XVII) chain; alpha 1 type XVII collagen; type XVII collagen alpha-1; collagen XVII, alpha-1 polypeptide; 180 kDa bullous pemphigoid antigen 2; bullous pemphigoid antigen 2 (180kD); bA16H23.2 (collagen, type X
UniProt Protein Name
Collagen alpha-1(XVII) chain
UniProt Gene Name
COL17A1
UniProt Synonym Gene Names
BP180; BPAG2; LAD-1; 97 kDa LAD antigen; 97-LAD; LABD97
UniProt Entry Name
COHA1_HUMAN

NCBI Description

This gene encodes the alpha chain of type XVII collagen. Unlike most collagens, collagen XVII is a transmembrane protein. Collagen XVII is a structural component of hemidesmosomes, multiprotein complexes at the dermal-epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. Mutations in this gene are associated with both generalized atrophic benign and junctional epidermolysis bullosa. Two homotrimeric forms of type XVII collagen exist. The full length form is the transmembrane protein. A soluble form, referred to as either ectodomain or LAD-1, is generated by proteolytic processing of the full length form. [provided by RefSeq, Jul 2008]

Uniprot Description

COL17A1: May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane. Defects in COL17A1 are a cause of generalized atrophic benign epidermolysis bullosa (GABEB). GABEB is a non- lethal, adult form of junctional epidermolysis bullosa characterized by life-long blistering of the skin, associated with hair and tooth abnormalities. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Extracellular matrix

Chromosomal Location of Human Ortholog: 10q24.3

Cellular Component: collagen; hemidesmosome; endoplasmic reticulum lumen; integral to plasma membrane; plasma membrane; extracellular region; basement membrane; intercellular junction

Molecular Function: protein binding

Biological Process: collagen catabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; epidermis development; hemidesmosome assembly; cell-matrix adhesion

Disease: Epidermolysis Bullosa, Junctional, Non-herlitz Type

Research Articles on COL17A1

Similar Products

Product Notes

The COL17A1 col17a1 (Catalog #AAA9142288) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Collagen XVII/COL17A1 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Collagen XVII/COL17A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the COL17A1 col17a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SVRRGSSYSS SMSTGGGGAG SLGAGGAFGE AAGDRGPYGT DIGPGGGYGA AAEGGMYAGN GGLLGADFAG DLDYNELAVR VSESMQRQGL LQGMAYTVQG P. It is sometimes possible for the material contained within the vial of "Collagen XVII/COL17A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.