Western Blot (WB)
(Host: RabbitTarget Name: GLT25D1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human COLGALT1 Polyclonal Antibody | anti-COLGALT1 antibody
COLGALT1 Antibody - middle region
Gene Names
COLGALT1; GLT25D1; ColGalT 1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
COLGALT1; Polyclonal Antibody; COLGALT1 Antibody - middle region; anti-COLGALT1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLYHSVEWRPAEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWA
Sequence Length
595
Applicable Applications for anti-COLGALT1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GLT25D1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GLT25D1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GLT25D1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-COLGALT1 antibody
The protein encoded by this gene is one of two enzymes that transfers galactose moieties to hydroxylysine residues of collagen and mannose binding lectin. This gene is constitutively expressed and encodes a soluble protein that localizes to the endoplasmic reticulum.
Product Categories/Family for anti-COLGALT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65 kDa
NCBI Official Full Name
procollagen galactosyltransferase 1
NCBI Official Synonym Full Names
collagen beta(1-O)galactosyltransferase 1
NCBI Official Symbol
COLGALT1
NCBI Official Synonym Symbols
GLT25D1; ColGalT 1
NCBI Protein Information
procollagen galactosyltransferase 1
UniProt Protein Name
Probable inactive glycosyltransferase 25 family member 3
Protein Family
UniProt Gene Name
CERCAM
UniProt Synonym Gene Names
CEECAM1; GLT25D3; KIAA1502
UniProt Entry Name
GT253_HUMAN
NCBI Description
The protein encoded by this gene is one of two enzymes that transfers galactose moieties to hydroxylysine residues of collagen and mannose binding lectin. This gene is constitutively expressed and encodes a soluble protein that localizes to the endoplasmic reticulum. [provided by RefSeq, Dec 2015]
Research Articles on COLGALT1
Similar Products
Product Notes
The COLGALT1 cercam (Catalog #AAA3222276) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COLGALT1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COLGALT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COLGALT1 cercam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLYHSVEWRP AEEPRSYPDE EGPKHWSDSR YEHVMKLRQA ALKSARDMWA. It is sometimes possible for the material contained within the vial of "COLGALT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
