Western Blot (WB)
(Host: RabbitTarget Name: COLEC10Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit COLEC10 Polyclonal Antibody | anti-COLEC10 antibody
COLEC10 Antibody - N-terminal region
Gene Names
COLEC10; 3MC3; CLL1; CL-34
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COLEC10; Polyclonal Antibody; COLEC10 Antibody - N-terminal region; anti-COLEC10 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IKGELGDMGDQGNIGKTGPIGKKGDKGEKGLLGIPGEKGKAGTVCDCGRY
Sequence Length
277
Applicable Applications for anti-COLEC10 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human COLEC10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: COLEC10Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: COLEC10Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-COLEC10 antibody
This is a rabbit polyclonal antibody against COLEC10. It was validated on Western Blot
Target Description: This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. The other members of this family are secreted proteins and bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. This gene product is a cytosolic protein, a characteristic that suggests that it may have different biological functions than other C-lectins.
Target Description: This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. The other members of this family are secreted proteins and bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. This gene product is a cytosolic protein, a characteristic that suggests that it may have different biological functions than other C-lectins.
Product Categories/Family for anti-COLEC10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
collectin-10 isoform 1
NCBI Official Synonym Full Names
collectin subfamily member 10
NCBI Official Symbol
COLEC10
NCBI Official Synonym Symbols
3MC3; CLL1; CL-34
NCBI Protein Information
collectin-10
UniProt Protein Name
Collectin-10
Protein Family
UniProt Gene Name
COLEC10
UniProt Synonym Gene Names
CLL1; CL-L1; CL-34
UniProt Entry Name
COL10_HUMAN
NCBI Description
This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. The other members of this family are secreted proteins and bind to carbohydrate antigens on microorganisms facilitating their recognition and removal. This gene product is a cytosolic protein, a characteristic that suggests that it may have different biological functions than other C-lectins. [provided by RefSeq, Jul 2008]
Uniprot Description
COLEC10: Lectin that binds to various sugars: galactose > mannose = fucose > N-acetylglucosamine > N-acetylgalactosamine. Belongs to the COLEC10/COLEC11 family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 8q23-q24.1
Cellular Component: collagen; cytoplasm; extracellular region
Molecular Function: mannose binding
Research Articles on COLEC10
Similar Products
Product Notes
The COLEC10 colec10 (Catalog #AAA3217336) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COLEC10 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COLEC10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COLEC10 colec10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IKGELGDMGD QGNIGKTGPI GKKGDKGEKG LLGIPGEKGK AGTVCDCGRY. It is sometimes possible for the material contained within the vial of "COLEC10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
