Western Blot (WB)
(COL9A3 rabbit polyclonal antibody. Western Blot analysis of COL9A3 expression in human kidney.)
Rabbit anti-Human COL9A3 Polyclonal Antibody | anti-COL9A3 antibody
COL9A3 (Collagen alpha-3(IX) Chain) APC
Gene Names
COL9A3; IDD; MED; EDM3; DJ885L7.4.1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COL9A3; Polyclonal Antibody; COL9A3 (Collagen alpha-3(IX) Chain) APC; anti-COL9A3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human COL9A3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
2428
Applicable Applications for anti-COL9A3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human COL9A3, aa1-684 (NP_001844.3).
Immunogen Sequence
MAGPRACAPLLLLLLLGELLAAAGAQRVGLPGPPGPPGPPGKPGQDGIDGEAGPPGLPGPPGPKGAPGKPGKPGEAGLPGLPGVDGLTGRDGPPGPKGAPGERGSLGPPGPPGLGGKGLPGPPGEAGVSGPPGGIGLRGPPGPSGLPGLPGPPGPPGPPGHPGVLPEGATDLQCPSICPPGPPGPPGMPGFKGPTGYKGEQGEVGKDGEKGDPGPPGPAGLPGSVGLQGPRGLRGLPGPLGPPGDRGPIGFRGPPGIPGAPGKAGDRGERGPEGFRGPKGDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGLPGRAGSKGEKGERGRAGELGEAGPSGEPGVPGDAGMPGERGEAGHRGSAGALGPQGPPGAPGVRGFQGQKGSMGDPGLPGPQGLRGDVGDRGPGGAAGPKGDQGIAGSDGLPGDKGELGPSGLVGPKGESGSRGELGPKGTQGPNGTSGVQGVPGPPGPLGLQGVPGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRPGPAGPPGPPGPPGSIGHPGARGPPGYRGPTGELGDPGPRGNQGDRGDKGAAGAGLDGPEGDQGPQGPQGVPGTSKDGQDGAPGEPGPPGDPGLPGAIGAQGTPGICDTSACQGAVLGGVGEKSGSRSS
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(COL9A3 rabbit polyclonal antibody. Western Blot analysis of COL9A3 expression in human kidney.)
Western Blot (WB)
(COL9A3 rabbit polyclonal antibody. Western Blot analysis of COL9A3 expression in human kidney.)
Western Blot (WB)
(Western Blot analysis of COL9A3 expression in transfected 293T cell line by COL9A3 polyclonal antibody. Lane 1: COL9A3 transfected lysate (63.6kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of COL9A3 expression in transfected 293T cell line by COL9A3 polyclonal antibody. Lane 1: COL9A3 transfected lysate (63.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-COL9A3 antibody
Structural component of hyaline cartilage and vitreous of the eye.
Product Categories/Family for anti-COL9A3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens collagen, type IX, alpha 3, mRNA
NCBI Official Synonym Full Names
collagen type IX alpha 3 chain
NCBI Official Symbol
COL9A3
NCBI Official Synonym Symbols
IDD; MED; EDM3; DJ885L7.4.1
NCBI Protein Information
collagen alpha-3(IX) chain
Protein Family
NCBI Description
This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia type 3. [provided by RefSeq, Jan 2010]
Research Articles on COL9A3
Similar Products
Product Notes
The COL9A3 (Catalog #AAA6374369) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COL9A3 (Collagen alpha-3(IX) Chain) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COL9A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COL9A3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COL9A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
