Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: COIA1Sample Type: MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit COL18A1 Polyclonal Antibody | anti-COL18A1 antibody

COL18A1 Antibody - Middle region

Gene Names
COL18A1; KS; KNO; KNO1
Reactivity
Cow, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity purified
Synonyms
COL18A1; Polyclonal Antibody; COL18A1 Antibody - Middle region; anti-COL18A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQLEARTPLPRGTDNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADD
Sequence Length
1339
Applicable Applications for anti-COL18A1 antibody
Western Blot (WB)
Homology
Cow: 92%; Horse: 83%; Human: 100%; Pig: 83%; Rabbit: 100%
Immunogen
The immunogen for Anti-COL18A1 antibody is: synthetic peptide directed towards the Middle region of Human COIA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: COIA1Sample Type: MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: COIA1Sample Type: MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-COL18A1 antibody
This is a rabbit polyclonal antibody against COIA1. It was validated on Western Blot

Target Description: This gene encodes the alpha chain of type XVIII collagen. This collagen is one of the multiplexins, extracellular matrix proteins that contain multiple triple-helix domains (collagenous domains) interrupted by non-collagenous domains. A long isoform of the protein has an N-terminal domain that is homologous to the extracellular part of frizzled receptors. Proteolytic processing at several endogenous cleavage sites in the C-terminal domain results in production of endostatin, a potent antiangiogenic protein that is able to inhibit angiogenesis and tumor growth. Mutations in this gene are associated with Knobloch syndrome. The main features of this syndrome involve retinal abnormalities, so type XVIII collagen may play an important role in retinal structure and in neural tube closure. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-COL18A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
147 kDa
NCBI Official Full Name
collagen alpha-1(XVIII) chain isoform 1 preproprotein
NCBI Official Synonym Full Names
collagen type XVIII alpha 1 chain
NCBI Official Symbol
COL18A1
NCBI Official Synonym Symbols
KS; KNO; KNO1
NCBI Protein Information
collagen alpha-1(XVIII) chain
UniProt Protein Name
Collagen alpha-1(XVIII) chain
Protein Family
UniProt Gene Name
COL18A1
UniProt Entry Name
COIA1_HUMAN

NCBI Description

This gene encodes the alpha chain of type XVIII collagen. This collagen is one of the multiplexins, extracellular matrix proteins that contain multiple triple-helix domains (collagenous domains) interrupted by non-collagenous domains. A long isoform of the protein has an N-terminal domain that is homologous to the extracellular part of frizzled receptors. Proteolytic processing at several endogenous cleavage sites in the C-terminal domain results in production of endostatin, a potent antiangiogenic protein that is able to inhibit angiogenesis and tumor growth. Mutations in this gene are associated with Knobloch syndrome. The main features of this syndrome involve retinal abnormalities, so type XVIII collagen may play an important role in retinal structure and in neural tube closure. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

COL18A1: COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube. Defects in COL18A1 are a cause of Knobloch syndrome type 1 (KNO1). An autosomal recessive disorder defined by the occurrence of high myopia, vitreoretinal degeneration with retinal detachment, macular abnormalities and occipital encephalocele. Belongs to the multiplexin collagen family. 3 isoforms of the human protein are produced by alternative promoter.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: extracellular matrix; extracellular space; collagen; endoplasmic reticulum lumen; extracellular region; basement membrane

Molecular Function: identical protein binding; protein binding; metal ion binding; structural molecule activity

Biological Process: response to drug; extracellular matrix organization and biogenesis; collagen catabolic process; extracellular matrix disassembly; negative regulation of cell proliferation; organ morphogenesis; visual perception; positive regulation of cell proliferation; endothelial cell morphogenesis; angiogenesis; cell adhesion; response to hydrostatic pressure; positive regulation of cell migration

Disease: Knobloch Syndrome 1

Research Articles on COL18A1

Similar Products

Product Notes

The COL18A1 col18a1 (Catalog #AAA3207955) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COL18A1 Antibody - Middle region reacts with Cow, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's COL18A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COL18A1 col18a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQLEARTPLP RGTDNEVAAL QPPVVQLHDS NPYPRREHPH PTARPWRADD. It is sometimes possible for the material contained within the vial of "COL18A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.