Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CNNM2 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Rabbit CNNM2 Polyclonal Antibody | anti-CNNM2 antibody

CNNM2 antibody - middle region

Gene Names
CNNM2; ACDP2; HOMG6; HOMGSMR
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNNM2; Polyclonal Antibody; CNNM2 antibody - middle region; anti-CNNM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL
Sequence Length
875
Applicable Applications for anti-CNNM2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CNNM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CNNM2 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-CNNM2 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Related Product Information for anti-CNNM2 antibody
This is a rabbit polyclonal antibody against CNNM2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CNNM2 is a divalent metal cation transporter. CNNM2 mediates transport of divalent metal cations in an order of Mg2+ > Co2+ > Mn2+ > Sr2+ > Ba2+ > Cu2+ > Fe2+.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
metal transporter CNNM2 isoform 1
NCBI Official Synonym Full Names
cyclin and CBS domain divalent metal cation transport mediator 2
NCBI Official Symbol
CNNM2
NCBI Official Synonym Symbols
ACDP2; HOMG6; HOMGSMR
NCBI Protein Information
metal transporter CNNM2
UniProt Protein Name
Metal transporter CNNM2
Protein Family
UniProt Gene Name
CNNM2
UniProt Synonym Gene Names
ACDP2
UniProt Entry Name
CNNM2_HUMAN

NCBI Description

This gene encodes a member of the ancient conserved domain containing protein family. Members of this protein family contain a cyclin box motif and have structural similarity to the cyclins. The encoded protein may play an important role in magnesium homeostasis by mediating the epithelial transport and renal reabsorption of Mg2+. Mutations in this gene are associated with renal hypomagnesemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

CNNM2: Divalent metal cation transporter. Mediates transport of divalent metal cations in an order of Mg(2+) > Co(2+) > Mn(2+) > Sr(2+) > Ba(2+) > Cu(2+) > Fe(2+). Defects in CNNM2 are the cause of hypomagnesemia type 6 (HOMG6). A renal disease characterized by severely lowered serum magnesium levels in the absence of other electrolyte disturbances. Affected individuals show an inappropriately normal urinary magnesium excretion, demonstrating a defect in tubular reabsorption. Age of clinical onset is highly variable and some affected individuals are asymptomatic. Belongs to the ACDP family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Cell cycle regulation; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10q24.32

Cellular Component: basolateral plasma membrane; integral to membrane

Biological Process: magnesium ion transport

Disease: Hypomagnesemia, Seizures, And Mental Retardation; Hypomagnesemia 6, Renal

Research Articles on CNNM2

Similar Products

Product Notes

The CNNM2 cnnm2 (Catalog #AAA3208519) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNNM2 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CNNM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNNM2 cnnm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EIIKSEILDE TDLYTDNRTK KKVAHRERKQ DFSAFKQTDS EMKVKISPQL. It is sometimes possible for the material contained within the vial of "CNNM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.