Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CNBP antibody - N-terminal region validated by WB using human primary myoblasts at 1:1000.)

Rabbit CNBP Polyclonal Antibody | anti-CNBP antibody

CNBP antibody - N-terminal region

Gene Names
CNBP; DM2; ZNF9; CNBP1; PROMM; RNF163; ZCCHC22
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNBP; Polyclonal Antibody; CNBP antibody - N-terminal region; anti-CNBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLP
Sequence Length
177
Applicable Applications for anti-CNBP antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CNBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(CNBP antibody - N-terminal region validated by WB using human primary myoblasts at 1:1000.)

Western Blot (WB) (CNBP antibody - N-terminal region validated by WB using human primary myoblasts at 1:1000.)

Western Blot (WB)

(Host: RabbitTarget Name: CNBPSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CNBPSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-CNBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-CNBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: Human brain)
Related Product Information for anti-CNBP antibody
This is a rabbit polyclonal antibody against CNBP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CNBP is a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene.This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
cellular nucleic acid-binding protein isoform 3
NCBI Official Synonym Full Names
CCHC-type zinc finger nucleic acid binding protein
NCBI Official Symbol
CNBP
NCBI Official Synonym Symbols
DM2; ZNF9; CNBP1; PROMM; RNF163; ZCCHC22
NCBI Protein Information
cellular nucleic acid-binding protein
UniProt Protein Name
Cellular nucleic acid-binding protein
UniProt Gene Name
CNBP
UniProt Synonym Gene Names
RNF163; ZNF9; CNBP
UniProt Entry Name
CNBP_HUMAN

NCBI Description

This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion from <30 repeats to 75-11000 repeats in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2016]

Uniprot Description

ZNF9: Single stranded DNA-binding protein, with specificity to the sterol regulatory element (SRE). Involved in sterol-mediated repression. Defects in CNBP are the cause of dystrophia myotonica type 2 (DM2); also known as proximal myotonic myopathy (PROMM). A multisystem disease characterized by the association of proximal muscle weakness with myotonia, cardiac manifestations and cataract. Additional features can include hyperhidrosis, testicular atrophy, insulin resistance and diabetes and central nervous system anomalies in rare cases. The causative mutation is a CCTG expansion (mean approximately 5000 repeats) located in intron 1 of the CNBP gene. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; RNA-binding; DNA-binding

Chromosomal Location of Human Ortholog: 3q21

Cellular Component: endoplasmic reticulum; nucleus; cytosol

Molecular Function: protein binding; single-stranded RNA binding; zinc ion binding; transcription factor activity; single-stranded DNA binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; cholesterol biosynthetic process

Disease: Myotonic Dystrophy 2

Research Articles on CNBP

Similar Products

Product Notes

The CNBP cnbp (Catalog #AAA3202307) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNBP antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CNBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNBP cnbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSNECFKCGR SGHWARECPT GGGRGRGMRS RGRGGFTSDR GFQFVSSSLP. It is sometimes possible for the material contained within the vial of "CNBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.