Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CMTM1 expression in transfected 293T cell line by CMTM1 polyclonal antibody. Lane 1: CMTM1 transfected lysate (12.54kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CMTM1 Polyclonal Antibody | anti-CMTM1 antibody

CMTM1 (CKLF-like MARVEL Transmembrane Domain-containing Protein 1, Chemokine-like Factor Superfamily Member 1, CKLFSF1, MGC71870)

Gene Names
CMTM1; CKLFH; CKLFH1; CKLFSF1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CMTM1; Polyclonal Antibody; CMTM1 (CKLF-like MARVEL Transmembrane Domain-containing Protein 1; Chemokine-like Factor Superfamily Member 1; CKLFSF1; MGC71870); Anti -CMTM1 (CKLF-like MARVEL Transmembrane Domain-containing Protein 1; anti-CMTM1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CMTM1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGR
Applicable Applications for anti-CMTM1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CMTM1, aa1-114 (NP_851787.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CMTM1 expression in transfected 293T cell line by CMTM1 polyclonal antibody. Lane 1: CMTM1 transfected lysate (12.54kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CMTM1 expression in transfected 293T cell line by CMTM1 polyclonal antibody. Lane 1: CMTM1 transfected lysate (12.54kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-CMTM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18,576 Da
NCBI Official Full Name
CKLF-like MARVEL transmembrane domain-containing protein 1 isoform 13
NCBI Official Synonym Full Names
CKLF-like MARVEL transmembrane domain containing 1
NCBI Official Symbol
CMTM1
NCBI Official Synonym Symbols
CKLFH; CKLFH1; CKLFSF1
NCBI Protein Information
CKLF-like MARVEL transmembrane domain-containing protein 1; chemokine-like factor superfamily 1; chemokine-like factor super family 1; chemokine-like factor-like protein CKLFH1; chemokine-like factor superfamily member 1
UniProt Protein Name
CKLF-like MARVEL transmembrane domain-containing protein 1
UniProt Gene Name
CMTM1
UniProt Synonym Gene Names
CKLFSF1
UniProt Entry Name
CKLF1_HUMAN

NCBI Description

This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CKLF (chemokine-like factor).[provided by RefSeq, Feb 2011]

Uniprot Description

CMTM1: a member of the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CKLF (chemokine-like factor).[provided by RefSeq, Feb 2011]

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16q21

Cellular Component: extracellular space; integral to membrane

Molecular Function: cytokine activity

Biological Process: chemotaxis

Research Articles on CMTM1

Similar Products

Product Notes

The CMTM1 cmtm1 (Catalog #AAA6012143) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CMTM1 (CKLF-like MARVEL Transmembrane Domain-containing Protein 1, Chemokine-like Factor Superfamily Member 1, CKLFSF1, MGC71870) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CMTM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CMTM1 cmtm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDPEHAKPES SEAPSGNLKQ PETAAALSLI LGALACFIIT QANESFITIT SLEICIVVFF ILIYVLTLHH LLTYLHWPLL DLTNSIITAV FLSVVAILAM QEKKRRHLLY VGGR. It is sometimes possible for the material contained within the vial of "CMTM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.