Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CLEC9A Polyclonal Antibody | anti-CLEC9A antibody

Anti-CLEC9A Antibody

Gene Names
CLEC9A; CD370; DNGR1; DNGR-1; UNQ9341
Reactivity
Human
Applications
Immunohistochemistry, Immunocytochemistry, Flow Cytometry, Functional Assay
Purity
Immunogen Affinity Purified
Synonyms
CLEC9A; Polyclonal Antibody; Anti-CLEC9A Antibody; C-type lectin domain family 9 member A; UNQ9341/PRO34046; C-type lectin domain containing 9A; anti-CLEC9A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
241
Applicable Applications for anti-CLEC9A antibody
Immunohistochemistry (IHC) Frozen, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS)
Application Notes
IHC-F: 0.5-1 mug/ml
ICC: 0.5-1 mug/ml
FC/FACS: 1-3ug/1x106 cells
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-F and ICC.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Related Product Information for anti-CLEC9A antibody
Description: Rabbit IgG polyclonal antibody for CLEC9A detection. Tested with IHC-F, ICC, FCM in Human.
Background: C-type lectin domain family 9 member A is a protein that in humans is encoded by the CLEC9A gene. CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells. By genomic sequence analysis, this gene is mapped to chromosome 12p13.31, centromeric to CLEC12B (617573) and telomeric to CLEC1A (606782).
References
1. "Entrez Gene: C-type lectin domain family 9 member A". 2. Huysamen, C., Willment, J. A., Dennehy, K. M., Brown, G. D. CLEC9A is a novel activation C-type lectin-like receptor expressed on BDCA3+ dendritic cells and a subset of monocytes. J. Biol. Chem. 283: 16693-16701, 2008. 3. Sancho, D., Joffre, O. P., Keller, A. M., Rogers, N. C., Martinez, D., Hernanz-Falcon, P., Rosewell, I., Reis e Sousa, C. Identification of a dendritic cell receptor that couples sensing of necrosis to immunity. Nature 458: 899-903, 2009.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,324 Da
NCBI Official Full Name
C-type lectin domain family 9 member A
NCBI Official Synonym Full Names
C-type lectin domain containing 9A
NCBI Official Symbol
CLEC9A
NCBI Official Synonym Symbols
CD370; DNGR1; DNGR-1; UNQ9341
NCBI Protein Information
C-type lectin domain family 9 member A
UniProt Protein Name
C-type lectin domain family 9 member A
UniProt Gene Name
CLEC9A

NCBI Description

CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells (Huysamen et al., 2008 [PubMed 18408006]).[supplied by OMIM, Aug 2008]

Uniprot Description

Functions as an endocytic receptor on a small subset of myeloid cells specialized for the uptake and processing of material from dead cells. Recognizes filamentous form of actin in association with particular actin-binding domains of cytoskeletal proteins, including spectrin, exposed when cell membranes are damaged, and mediate the cross-presentation of dead-cell associated antigens in a Syk-dependent manner.

Research Articles on CLEC9A

Similar Products

Product Notes

The CLEC9A clec9a (Catalog #AAA1751474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CLEC9A Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC9A can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC) Frozen, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS). IHC-F: 0.5-1 mug/ml ICC: 0.5-1 mug/ml FC/FACS: 1-3ug/1x106 cells Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the CLEC9A clec9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLEC9A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.