Western Blot (WB)
(WB Suggested Anti-Cldn6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Heart)
Rabbit Cldn6 Polyclonal Antibody | anti-CLDN6 antibody
Cldn6 antibody - C-terminal region
Gene Names
Cldn6; AL024037
Reactivity
Tested: MousePredicted: Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Cldn6; Polyclonal Antibody; Cldn6 antibody - C-terminal region; anti-CLDN6 antibody
Host
Rabbit
Reactivity
Tested: Mouse
Predicted: Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted: Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 0.5-1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGP
Sequence Length
219
Applicable Applications for anti-CLDN6 antibody
Western Blot (WB)
Homology
Cow: 88%; Guinea Pig: 88%; Horse: 81%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Protein Size
219 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Cldn6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Cldn6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Heart)
Related Product Information for anti-CLDN6 antibody
This is a rabbit polyclonal antibody against Cldn6. It was validated on Western Blot
Target Description: Cldn6 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Target Description: Cldn6 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Product Categories/Family for anti-CLDN6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
claudin-6
NCBI Official Synonym Full Names
claudin 6
NCBI Official Symbol
Cldn6
NCBI Official Synonym Symbols
AL024037
NCBI Protein Information
claudin-6
UniProt Protein Name
Claudin-6
Protein Family
UniProt Gene Name
Cldn6
UniProt Entry Name
CLD6_MOUSE
NCBI Description
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is essential for blastocyst formation in preimplantation mouse embryos, and is invloved in and is crucial for the formation and maintenance of the epidermal permeability barrier. This gene is adjacent to another family member Cldn9 on chromosome 17. [provided by RefSeq, Aug 2010]
Research Articles on CLDN6
Similar Products
Product Notes
The CLDN6 cldn6 (Catalog #AAA3206582) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cldn6 antibody - C-terminal region reacts with Tested: Mouse Predicted: Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cldn6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLDN6 cldn6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GASLYLGWAA SGLLLLGGGL LCCACSSGGT QGPRHYMACY STSVPHSRGP. It is sometimes possible for the material contained within the vial of "Cldn6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
