Rabbit anti-Human CLDN15 Polyclonal Antibody | anti-CLDN15 antibody

CLDN15 (Claudin-15, Claudin 15, FLJ42715, MGC19536) (AP)

Cat. Num. AAA6374071

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CLDN15; Polyclonal Antibody; CLDN15 (Claudin-15; Claudin 15; FLJ42715; MGC19536) (AP); anti-CLDN15 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CLDN15.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 228

• Applicable Applications for anti-CLDN15 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CLDN15, aa1-228 (NP_055158.1).
• Immunogen Sequence: MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATAGALHILAGICGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWSASLISILGGLCLCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CLDN15 expression in transfected 293T cell line by CLDN15 polyclonal antibody. Lane 1: CLDN15 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CLDN15 antibody

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Product Categories/Family for anti-CLDN15 antibody

Antibodies; Claudin

NCBI and Uniprot Product Information

• NCBI GI #: 7656981
• NCBI GeneID: 24146
• NCBI Accession #: NP_055158.1
• NCBI GenBank Nucleotide #: NM_014343.1
• UniProt Accession #: P56746
• NCBI Official Full Name: claudin-15
• NCBI Official Synonym Full Names: claudin 15
• NCBI Official Symbol: CLDN15
• NCBI Protein Information: claudin-15
• UniProt Protein Name: Claudin-15
• Protein Family: Claudin
• UniProt Gene Name: CLDN15

NCBI Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members function as impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN15 forms tight junctions that mediate the paracellular transport of small monovalent cations along a concentration gradient, due to selective permeability for Na+, Li+ and K+ ions, but selects against Cl- ions. Plays an important role in paracellular Na+ transport in the intestine and in Na+ homeostasis. Required for normal Na+-dependent intestinal nutrient uptake.