Rabbit anti-Human CKMT1A Polyclonal Antibody | anti-CKMT1A antibody

CKMT1A (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT)

Cat. Num. AAA6004028

• Gene Names: CKMT1A; CKMT1
• Reactivity: Human
• Applications: Immunoprecipitation
• Purity: Serum; Serum
• Synonyms: CKMT1A; Polyclonal Antibody; CKMT1A (Creatine Kinase U-type; Mitochondrial; Ubiquitous Mitochondrial Creatine Kinase; U-MtCK; Acidic-type Mitochondrial Creatine Kinase; Mia-CK; CKMT; CKMT1B; CKMT); Anti -CKMT1A (Creatine Kinase U-type; anti-CKMT1A antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CKMT1B.
• Purity/Purification: Serum; Serum
• Form/Format: Supplied as a liquid.
• Sequence: MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH

• Applicable Applications for anti-CKMT1A antibody: Immunoprecipitation (IP)
• Application Notes: Suitable for use in Immunoprecipitation.
• Immunogen: Full length human CKMT1B, aa1-417 (NP_066270.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of CKMT1B transfected lysate using CKMT1B rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with CKMT1B mouse polyclonal antibody.)

Related Product Information for anti-CKMT1A antibody

Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase, this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase.

Product Categories/Family for anti-CKMT1A antibody

Antibodies; Abs to Enzymes; Creatine Kinase

NCBI and Uniprot Product Information

• NCBI GI #: 66346730
• NCBI GeneID: 548596
• NCBI Accession #: NP_001015001.1
• NCBI GenBank Nucleotide #: NM_001015001.1
• UniProt Accession #: P12532; Q0VAM3; Q32NF6; Q53FC4; B4DIT8; B7ZA09
• Molecular Weight: 47,037 Da
• NCBI Official Full Name: creatine kinase U-type, mitochondrial
• NCBI Official Synonym Full Names: creatine kinase, mitochondrial 1A
• NCBI Official Symbol: CKMT1A
• NCBI Official Synonym Symbols: CKMT1
• NCBI Protein Information: creatine kinase U-type, mitochondrial; U-MtCK; mia-CK; ubiquitous mitochondrial creatine kinase; acidic-type mitochondrial creatine kinase; creatine kinase, mitochondrial 1 (ubiquitous)
• UniProt Protein Name: Creatine kinase U-type, mitochondrial
• UniProt Gene Name: CKMT1A
• UniProt Synonym Gene Names: CKMT; Mia-CK; U-MtCK
• UniProt Entry Name: KCRU_HUMAN

NCBI Description

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

CKMT1A: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. Belongs to the ATP:guanido phosphotransferase family. Exists as an octamer composed of four MTCK homodimers. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.3.2; Kinase, other; Amino Acid Metabolism - arginine and proline; Mitochondrial

Chromosomal Location of Human Ortholog: 15q15

Cellular Component: mitochondrion; mitochondrial inner membrane

Molecular Function: creatine kinase activity; ATP binding

Biological Process: phosphorylation; creatine metabolic process