Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CIDEA expression in transfected 293T cell line by CIDEA polyclonal antibody. Lane 1: CIDEA transfected lysate (28.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CIDEA Polyclonal Antibody | anti-CIDEA antibody

CIDEA (Cell Death Activator CIDE-A, Cell Death-inducing DFFA-like Effector A, CIDE-A) (Biotin)

Gene Names
CIDEA; CIDE-A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CIDEA; Polyclonal Antibody; CIDEA (Cell Death Activator CIDE-A; Cell Death-inducing DFFA-like Effector A; CIDE-A) (Biotin); anti-CIDEA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CIDEA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CIDEA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CIDEA, aa1-253 (NP_938031.1).
Immunogen Sequence
MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CIDEA expression in transfected 293T cell line by CIDEA polyclonal antibody. Lane 1: CIDEA transfected lysate (28.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CIDEA expression in transfected 293T cell line by CIDEA polyclonal antibody. Lane 1: CIDEA transfected lysate (28.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CIDEA antibody
CIDEA is a 24-27kD member of the CIDE family of molecules. It is expressed in human adipocytes and striated muscle, plus mouse brown adipocytes and hepatocytes, and appears to have at least two functions. In the cytoplasm of fat cells, CIDEA localizes to lipid droplets and ER, and promotes the formation of lipid droplets at the expense of lipolysis and AMPK activity. In the nucleus, CIDEA apparently binds to LXR, and is capable of inducing apoptosis. CIDEA undergoes O-linked glycosylation. When glycosylated, CIDEA is nuclear; when nonglycosylated, CIDEA is cytoplasmic. Human CIDEA is 219aa in length, and contains one CIDE domain aa33-110 that potentially mediates dimerization. CIDEA reportedly homodimerizes, and heterodimerizes with CIDEB. There is one potential isoform variant that possesses a 46aa substitution for aa1-12. Over aa61-162, human CIDEA shares 89% aa identity with mouse CIDEA.
Product Categories/Family for anti-CIDEA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,314 Da
NCBI Official Full Name
cell death activator CIDE-A isoform 2 [Homo sapiens]
NCBI Official Synonym Full Names
cell death-inducing DFFA-like effector a
NCBI Official Symbol
CIDEA
NCBI Official Synonym Symbols
CIDE-A
NCBI Protein Information
cell death activator CIDE-A; OTTHUMP00000162472
UniProt Protein Name
Cell death activator CIDE-A variant 2
Protein Family
UniProt Gene Name
CIDEA
UniProt Entry Name
Q8N5P9_HUMAN

NCBI Description

This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Alternatively spliced transcripts have been identified. [provided by RefSeq]

Research Articles on CIDEA

Similar Products

Product Notes

The CIDEA cidea (Catalog #AAA6373985) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CIDEA (Cell Death Activator CIDE-A, Cell Death-inducing DFFA-like Effector A, CIDE-A) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CIDEA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CIDEA cidea for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CIDEA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.