Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-CHST2 Polyclonal Antibody)

Rabbit anti-Human CHST2 Polyclonal Antibody | anti-CHST2 antibody

CHST2 Polyclonal Antibody

Gene Names
CHST2; C6ST; GST2; GST-2; Gn6ST-1; HEL-S-75; glcNAc6ST-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CHST2; Polyclonal Antibody; CHST2 Polyclonal Antibody; C6ST; GST-2; GST2; Gn6ST-1; HEL-S-75; glcNAc6ST-1; carbohydrate sulfotransferase 2; anti-CHST2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.15 mg/ml (varies by lot)
Sequence Length
530
Applicable Applications for anti-CHST2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 231-530 of human CHST2 (NP_004258.2).
Immunogen Sequence
FQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVCKKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIRESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHYLVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Positive Samples
U-251MG
Cellular Location
Golgi Apparatus, Single-Pass Type II Membrane Protein, Trans-Golgi Network Membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CHST2 Polyclonal Antibody)

Western Blot (WB) (Western blot-CHST2 Polyclonal Antibody)
Related Product Information for anti-CHST2 antibody
This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 52kDa; 57kDa
Observed: 60kDa
NCBI Official Full Name
carbohydrate sulfotransferase 2
NCBI Official Synonym Full Names
carbohydrate sulfotransferase 2
NCBI Official Symbol
CHST2
NCBI Official Synonym Symbols
C6ST; GST2; GST-2; Gn6ST-1; HEL-S-75; glcNAc6ST-1
NCBI Protein Information
carbohydrate sulfotransferase 2
UniProt Protein Name
Carbohydrate sulfotransferase 2
UniProt Gene Name
CHST2
UniProt Synonym Gene Names
GN6ST; GST-2; GlcNAc6ST-1; Gn6ST-1
UniProt Entry Name
CHST2_HUMAN

NCBI Description

This locus encodes a sulfotransferase protein. The encoded enzyme catalyzes the sulfation of a nonreducing N-acetylglucosamine residue, and may play a role in biosynthesis of 6-sulfosialyl Lewis X antigen. [provided by RefSeq, Aug 2011]

Uniprot Description

CHST2: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within keratan-like structures on N-linked glycans and within mucin-associated glycans that can ultimately serve as SELL ligands. SELL ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Participates in biosynthesis of the SELL ligand sialyl 6-sulfo Lewis X and in lymphocyte homing to Peyer patches. Has no activity toward O-linked sugars. Its substrate specificity may be influenced by its subcellular location. Sulfates GlcNAc residues at terminal, non-reducing ends of oligosaccharide chains. Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Membrane protein, integral; Transferase; EC 2.8.2.-; Glycan Metabolism - keratan sulfate biosynthesis

Chromosomal Location of Human Ortholog: 3q24

Cellular Component: Golgi membrane; intrinsic to Golgi membrane; integral to membrane; trans-Golgi network

Molecular Function: sulfotransferase activity; N-acetylglucosamine 6-O-sulfotransferase activity

Biological Process: keratan sulfate metabolic process; sulfur metabolic process; glycosaminoglycan metabolic process; multicellular organismal development; carbohydrate metabolic process; keratan sulfate biosynthetic process; N-acetylglucosamine metabolic process; pathogenesis; inflammatory response

Research Articles on CHST2

Similar Products

Product Notes

The CHST2 chst2 (Catalog #AAA9140478) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHST2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHST2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CHST2 chst2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHST2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.