Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Chst2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Rabbit Chst2 Polyclonal Antibody | anti-CHST2 antibody

Chst2 antibody - middle region

Gene Names
Chst2; Chts2; GST-2; Gn6st; AI428561; AW121776; GlcNAc6ST; C130041E03Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Chst2; Polyclonal Antibody; Chst2 antibody - middle region; anti-CHST2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV
Sequence Length
530
Applicable Applications for anti-CHST2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Chst2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Western Blot (WB) (WB Suggested Anti-Chst2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-CHST2 antibody
This is a rabbit polyclonal antibody against Chst2. It was validated on Western Blot

Target Description: Chst2 catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within keratan-like structures on N-linked glycans and within mucin-associated glycans that can ultimately serve as L-selectin ligands. L-selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Chst2 participates in biosynthesis of L-selectin ligand sialyl 6-sulfo Lewis X and in lymphocyte homing to Peyer patches. It has no activity toward O-linked sugars. Its substrate specificity may be influenced by its subcellular location. It sulfates GlcNAc residues at terminal, non-reducing ends of oligosaccharide chains.
Product Categories/Family for anti-CHST2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
carbohydrate sulfotransferase 2
NCBI Official Synonym Full Names
carbohydrate sulfotransferase 2
NCBI Official Symbol
Chst2
NCBI Official Synonym Symbols
Chts2; GST-2; Gn6st; AI428561; AW121776; GlcNAc6ST; C130041E03Rik
NCBI Protein Information
carbohydrate sulfotransferase 2
UniProt Protein Name
Carbohydrate sulfotransferase 2
UniProt Gene Name
Chst2
UniProt Synonym Gene Names
Gst2; GST-2; GlcNAc6ST-1; Gn6st-1

Uniprot Description

CHST2: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within keratan-like structures on N-linked glycans and within mucin-associated glycans that can ultimately serve as SELL ligands. SELL ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Participates in biosynthesis of the SELL ligand sialyl 6-sulfo Lewis X and in lymphocyte homing to Peyer patches. Has no activity toward O-linked sugars. Its substrate specificity may be influenced by its subcellular location. Sulfates GlcNAc residues at terminal, non-reducing ends of oligosaccharide chains. Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: EC 2.8.2.-; Glycan Metabolism - keratan sulfate biosynthesis; Membrane protein, integral; Transferase

Chromosomal Location of Human Ortholog: 9|9 E3.3

Cellular Component: Golgi apparatus; Golgi membrane; integral component of membrane; membrane; trans-Golgi network

Molecular Function: N-acetylglucosamine 6-O-sulfotransferase activity; sulfotransferase activity; transferase activity

Biological Process: carbohydrate metabolic process; inflammatory response; N-acetylglucosamine metabolic process; sulfur compound metabolic process

Research Articles on CHST2

Similar Products

Product Notes

The CHST2 chst2 (Catalog #AAA3208205) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Chst2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Chst2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHST2 chst2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFQLYSPAGS GGRNLTTLGI FGAATNKVVC SSPLCPAYRK EVVGLVDDRV. It is sometimes possible for the material contained within the vial of "Chst2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.