Mouse anti-Human CHRNA4 Monoclonal Antibody | anti-CHRNA4 antibody

CHRNA4 (Neuronal Acetylcholine Receptor Subunit alpha-4, NACRA4) APC

Cat. Num. AAA6135889

• Gene Names: CHRNA4; EBN; BFNC; EBN1; NACHR; NACRA4; NACHRA4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CHRNA4; Monoclonal Antibody; CHRNA4 (Neuronal Acetylcholine Receptor Subunit alpha-4; NACRA4) APC; anti-CHRNA4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4E3
• Specificity: Recognizes human CHRNA4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CHRNA4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa29-129 from human CHRNA4 (NP_000735) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Related Product Information for anti-CHRNA4 antibody

This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described.

Product Categories/Family for anti-CHRNA4 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4502827
• NCBI GeneID: 1137
• NCBI Accession #: NP_000735
• NCBI GenBank Nucleotide #: NM_000744
• UniProt Accession #: P43681; Q4JGR7; Q4VAQ5; Q4VAQ6
• Molecular Weight: 60,994 Da
• NCBI Official Full Name: neuronal acetylcholine receptor subunit alpha-4 isoform 1
• NCBI Official Synonym Full Names: cholinergic receptor, nicotinic, alpha 4 (neuronal)
• NCBI Official Symbol: CHRNA4
• NCBI Official Synonym Symbols: EBN; BFNC; EBN1; NACHR; NACRA4; NACHRA4
• NCBI Protein Information: neuronal acetylcholine receptor subunit alpha-4; cholinergic receptor, nicotinic, alpha polypeptide 4; neuronal nicotinic acetylcholine receptor alpha-4 subunit
• UniProt Protein Name: Neuronal acetylcholine receptor subunit alpha-4
• Protein Family: Neuronal acetylcholine receptor
• UniProt Gene Name: CHRNA4
• UniProt Synonym Gene Names: NACRA4
• UniProt Entry Name: ACHA4_HUMAN

Uniprot Description

nAChRA4: a ligand-gated ion channels that binds acetylcholine and mediates fast signal transmission at synapses. After binding acetylcholine, these pentameric receptors undergo an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. An integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, ligand-gated; Receptor, misc.

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; cell soma; membrane; dendrite; integral to membrane; plasma membrane; cell junction; external side of plasma membrane

Molecular Function: acetylcholine receptor activity; acetylcholine binding; nicotinic acetylcholine-activated cation-selective channel activity; ligand-gated ion channel activity

Biological Process: response to nicotine; regulation of action potential; B cell activation; behavioral response to nicotine; locomotory behavior; respiratory gaseous exchange; signal transduction; DNA repair; sensory perception of pain; regulation of dopamine secretion; synaptic transmission, cholinergic; neurological system process; regulation of inhibitory postsynaptic membrane potential; synaptic transmission; membrane depolarization; regulation of membrane potential; calcium ion transport; response to hypoxia; ion transport; response to oxidative stress; cognition

Disease: Epilepsy, Nocturnal Frontal Lobe, 1; Tobacco Addiction, Susceptibility To