Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHRNA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)

Rabbit CHRNA3 Polyclonal Antibody | anti-CHRNA3 antibody

CHRNA3 antibody - N-terminal region

Gene Names
CHRNA3; LNCR2; PAOD2; NACHRA3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHRNA3; Polyclonal Antibody; CHRNA3 antibody - N-terminal region; anti-CHRNA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN
Sequence Length
505
Applicable Applications for anti-CHRNA3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHRNA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-CHRNA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)
Related Product Information for anti-CHRNA3 antibody
This is a rabbit polyclonal antibody against CHRNA3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
neuronal acetylcholine receptor subunit alpha-3 isoform 1
NCBI Official Synonym Full Names
cholinergic receptor nicotinic alpha 3 subunit
NCBI Official Symbol
CHRNA3
NCBI Official Synonym Symbols
LNCR2; PAOD2; NACHRA3
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-3
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-3
UniProt Gene Name
CHRNA3
UniProt Synonym Gene Names
NACHRA3
UniProt Entry Name
ACHA3_HUMAN

NCBI Description

This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described. [provided by RefSeq, Nov 2009]

Uniprot Description

nAChRA3: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha- 3/CHRNA3 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, ligand-gated; Membrane protein, integral; Channel, cation; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 15q24

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; postsynaptic membrane; cell soma; dendrite; postsynaptic density; plasma membrane; integral to membrane; cell junction

Molecular Function: acetylcholine receptor activity; acetylcholine binding; nicotinic acetylcholine-activated cation-selective channel activity; ligand-gated ion channel activity

Biological Process: regulation of smooth muscle contraction; nervous system development; transmembrane receptor protein tyrosine kinase activation (dimerization); regulation of dendrite morphogenesis; regulation of acetylcholine secretion; behavioral response to nicotine; locomotory behavior; signal transduction; synaptic transmission, cholinergic; synaptic transmission; regulation of membrane potential; ion transport; synaptic transmission involved in micturition; regulation of excitatory postsynaptic membrane potential

Disease: Smoking As A Quantitative Trait Locus 3

Research Articles on CHRNA3

Similar Products

Product Notes

The CHRNA3 chrna3 (Catalog #AAA3202376) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRNA3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CHRNA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHRNA3 chrna3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHRLFERLFE DYNEIIRPVA NVSDPVIIHF EVSMSQLVKV DEVNQIMETN. It is sometimes possible for the material contained within the vial of "CHRNA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.