Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit CHN1 Polyclonal Antibody | anti-CHN1 antibody

CHN1 antibody - middle region

Gene Names
CHN1; NC; CHN; DURS2; ARHGAP2; RHOGAP2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHN1; Polyclonal Antibody; CHN1 antibody - middle region; anti-CHN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE
Sequence Length
459
Applicable Applications for anti-CHN1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 77%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CHN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-CHN1 antibody
This is a rabbit polyclonal antibody against CHN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms.
Product Categories/Family for anti-CHN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
N-chimaerin isoform 1
NCBI Official Synonym Full Names
chimerin 1
NCBI Official Symbol
CHN1
NCBI Official Synonym Symbols
NC; CHN; DURS2; ARHGAP2; RHOGAP2
NCBI Protein Information
N-chimaerin
UniProt Protein Name
N-chimaerin
Protein Family
UniProt Gene Name
CHN1
UniProt Synonym Gene Names
ARHGAP2; CHN; NC
UniProt Entry Name
CHIN_HUMAN

NCBI Description

This gene encodes GTPase-activating protein for ras-related p21-rac and a phorbol ester receptor. It is predominantly expressed in neurons, and plays an important role in neuronal signal-transduction mechanisms. Mutations in this gene are associated with Duane's retraction syndrome 2 (DURS2). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Apr 2011]

Uniprot Description

ARHGAP2: GTPase-activating protein for p21-rac and a phorbol ester receptor. Involved in the assembly of neuronal locomotor circuits as a direct effector of EPHA4 in axon guidance. Interacts with EPHA4; effector of EPHA4 in axon guidance linking EPHA4 activation to RAC1 regulation. In neurons in brain regions that are involved in learning and memory processes. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; Adaptor/scaffold; GAPs, Rac/Rho

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: cytosol

Molecular Function: SH3/SH2 adaptor activity; ephrin receptor binding; metal ion binding; GTPase activator activity

Biological Process: regulation of small GTPase mediated signal transduction; positive regulation of signal transduction; small GTPase mediated signal transduction; ephrin receptor signaling pathway; motor axon guidance; regulation of axonogenesis; positive regulation of GTPase activity

Disease: Duane Retraction Syndrome 2

Research Articles on CHN1

Similar Products

Product Notes

The CHN1 chn1 (Catalog #AAA3210539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHN1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CHN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHN1 chn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVYSCDLTTL VKAHTTKRPM VVDMCIREIE SRGLNSEGLY RVSGFSDLIE. It is sometimes possible for the material contained within the vial of "CHN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.