Rabbit anti-Human, Mouse CHIA Polyclonal Antibody | anti-CHIA antibody

CHIA (Acidic Mammalian Chitinase, AMCase, Lung-specific Protein TSA1902) APC

Cat. Num. AAA6373852

• Gene Names: CHIA; CHIT2; AMCASE; TSA1902
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CHIA; Polyclonal Antibody; CHIA (Acidic Mammalian Chitinase; AMCase; Lung-specific Protein TSA1902) APC; anti-CHIA antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CHIA. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 368

• Applicable Applications for anti-CHIA antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CHIA, aa1-368 (NP_068569.2).
• Immunogen Sequence: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CHIA rabbit polyclonal antibody. Western Blot analysis of CHIA expression in mouse intestine.)

Western Blot (WB)

(Western Blot analysis of CHIA expression in transfected 293T cell line by CHIA polyclonal antibody. Lane 1: CHIA transfected lysate (40.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CHIA antibody

CHIA degrades chitin and chitotriose. May participate in the defense against nematodes and other pathogens. There are 3 named isoforms produced by alternative splicing. CHIA is induced via a T helper-2 (Th2)-specific, interleukin-13-mediated pathway in epithelial cells and macrophages. CHIA may be an important mediator of IL13-induced responses in Th2-dominated disorders such as asthma. CHIA hydrolysis N-acetyl-beta-D-glucosaminide 1,4-beta-linkages in chitin and chitodextrins.

Product Categories/Family for anti-CHIA antibody

Antibodies; Enzymes; Glycosidase

NCBI and Uniprot Product Information

• NCBI GI #: 42542398
• NCBI GeneID: 27159
• NCBI Accession #: NP_068569.2
• NCBI GenBank Nucleotide #: NM_021797.2
• UniProt Accession #: Q9BZP6
• NCBI Official Full Name: acidic mammalian chitinase isoform a
• NCBI Official Synonym Full Names: chitinase acidic
• NCBI Official Symbol: CHIA
• NCBI Official Synonym Symbols: CHIT2; AMCASE; TSA1902
• NCBI Protein Information: acidic mammalian chitinase
• UniProt Protein Name: Acidic mammalian chitinase
• Protein Family: Chitinase
• UniProt Gene Name: CHIA
• UniProt Synonym Gene Names: AMCase
• UniProt Entry Name: CHIA_HUMAN

NCBI Description

The protein encoded by this gene degrades chitin, which is found in the cell wall of most fungi as well as in arthropods and some nematodes. The encoded protein can also stimulate interleukin 13 expression, and variations in this gene can lead to asthma susceptibility. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

CHIA: Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding. Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Secreted, signal peptide; Secreted; EC 3.2.1.14

Chromosomal Location of Human Ortholog: 1p13.2

Cellular Component: extracellular space; cytoplasm

Molecular Function: lysozyme activity; chitin binding; chitinase activity; carbohydrate binding; kinase binding

Biological Process: response to fungus; polysaccharide catabolic process; apoptosis; production of molecular mediator of acute inflammatory response; cell wall chitin metabolic process; digestion; immune response; chitin catabolic process; chitin metabolic process