Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of CHAT expression in HELA whole cell lysates (lane 1). CHAT at 83KD was detected using rabbit anti- CHAT Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human CHAT Polyclonal Antibody | anti-CHAT antibody

Anti-CHAT Antibody

Gene Names
CHAT; CMS6; CMS1A; CMS1A2; CHOACTASE
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
CHAT; Polyclonal Antibody; Anti-CHAT Antibody; ChAT; CHOACTase; Choline acetylase; choline acetyltransferase; Choline O acetyltransferase; CMS1A; CMS1A2; CMS6; P28329; Choline O-acetyltransferase; anti-CHAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
630
Applicable Applications for anti-CHAT antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CHAT (177-213aa ETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVN), different from the related mouse and rat sequences by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of CHAT expression in HELA whole cell lysates (lane 1). CHAT at 83KD was detected using rabbit anti- CHAT Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of CHAT expression in HELA whole cell lysates (lane 1). CHAT at 83KD was detected using rabbit anti- CHAT Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-CHAT antibody
Rabbit IgG polyclonal antibody for Choline O-acetyltransferase(CHAT) detection.
Background: Choline acetyltransferase (commonly abbreviated as ChAT, but sometimes CAT) is a transferase enzyme responsible for the synthesis of the neurotransmitter acetylcholine. In humans, the choline acetyltransferase enzyme is encoded by the CHAT gene. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.
References
1. Berman R, Wilson IB, Nachmansohn D (September-October 1953). "Choline acetylase specificity in relation to biological function.". Biochimica et Biophysica Acta. 12 (1-2): 315-24.
2. Strauss WL, Kemper RR, Jayakar P, Kong CF, Hersh LB, Hilt DC, Rabin M (February 1991). "Human choline acetyltransferase gene maps to region 10q11-q22.2 by in situ hybridization". Genomics. 9 (2): 396-8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,394 Da
NCBI Official Full Name
choline O-acetyltransferase isoform 1
NCBI Official Synonym Full Names
choline O-acetyltransferase
NCBI Official Symbol
CHAT
NCBI Official Synonym Symbols
CMS6; CMS1A; CMS1A2; CHOACTASE
NCBI Protein Information
choline O-acetyltransferase
UniProt Protein Name
Choline O-acetyltransferase
UniProt Gene Name
CHAT
UniProt Synonym Gene Names
CHOACTase; ChAT; Choline acetylase

NCBI Description

This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform. [provided by RefSeq, May 2010]

Uniprot Description

CHAT: an enzyme that catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses. Four alternative splice variants have been described.

Protein type: Acetyltransferase; EC 2.3.1.6; Lipid Metabolism - glycerophospholipid

Chromosomal Location of Human Ortholog: 10q11.23

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: choline O-acetyltransferase activity

Biological Process: neurotransmitter secretion; phosphatidylcholine biosynthetic process

Disease: Myasthenic Syndrome, Congenital, Associated With Episodic Apnea

Research Articles on CHAT

Similar Products

Product Notes

The CHAT chat (Catalog #AAA178638) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CHAT Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHAT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the CHAT chat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CHAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.