Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHAC1Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

Rabbit CHAC1 Polyclonal Antibody | anti-CHAC1 antibody

CHAC1 antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHAC1; Polyclonal Antibody; CHAC1 antibody - C-terminal region; anti-CHAC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
Sequence Length
222
Applicable Applications for anti-CHAC1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CHAC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHAC1Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHAC1Sample Tissue: Human RPMI 8226 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-CHAC1 antibody
This is a rabbit polyclonal antibody against CHAC1. It was validated on Western Blot

Target Description: CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.
Product Categories/Family for anti-CHAC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
glutathione-specific gamma-glutamylcyclotransferase 1 isoform a
NCBI Official Synonym Full Names
ChaC glutathione specific gamma-glutamylcyclotransferase 1
NCBI Official Symbol
CHAC1
NCBI Protein Information
glutathione-specific gamma-glutamylcyclotransferase 1
UniProt Protein Name
Cation transport regulator-like protein 1
UniProt Gene Name
CHAC1
UniProt Synonym Gene Names
BOTCH; Botch
UniProt Entry Name
CHAC1_HUMAN

NCBI Description

This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients. [provided by RefSeq, Sep 2016]

Uniprot Description

CHAC1: Negative regulator of Notch signaling pathway involved in embryonic neurogenesis: acts by inhibiting Notch cleavage by furin, maintaining Notch in an immature inactive form, thereby promoting neurogenesis in embryos. May also act as a pro-apoptotic component of the unfolded protein response pathway by mediating the pro-apoptotic effects of the ATF4-ATF3-DDIT3/CHOP cascade. Belongs to the chaC family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 15q15.1

Cellular Component: trans-Golgi network; cytosol

Molecular Function: protein binding; transferase activity, transferring acyl groups; Notch binding

Biological Process: Notch signaling pathway; neurogenesis; metabolic process; negative regulation of Notch signaling pathway; response to unfolded protein

Research Articles on CHAC1

Similar Products

Product Notes

The CHAC1 chac1 (Catalog #AAA3206470) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHAC1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHAC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHAC1 chac1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPQNPGYLGP APEEAIATQI LACRGFSGHN LEYLLRLADF MQLCGPQAQD. It is sometimes possible for the material contained within the vial of "CHAC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.