Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CGGBP1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Rabbit CGGBP1 Polyclonal Antibody | anti-CGGBP1 antibody

CGGBP1 Antibody - N-terminal region

Gene Names
CGGBP1; CGGBP; p20-CGGBP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CGGBP1; Polyclonal Antibody; CGGBP1 Antibody - N-terminal region; anti-CGGBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLT
Sequence Length
167
Applicable Applications for anti-CGGBP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CGGBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CGGBP1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Western Blot (WB) (WB Suggested Anti-CGGBP1 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Related Product Information for anti-CGGBP1 antibody
This is a rabbit polyclonal antibody against CGGBP1. It was validated on Western Blot

Target Description: CGGBP1 influences expression of the FMR1 gene, which is associated with the fragile X mental retardation syndrome, by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR.
Product Categories/Family for anti-CGGBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
CGG triplet repeat-binding protein 1
NCBI Official Synonym Full Names
CGG triplet repeat binding protein 1
NCBI Official Symbol
CGGBP1
NCBI Official Synonym Symbols
CGGBP; p20-CGGBP
NCBI Protein Information
CGG triplet repeat-binding protein 1
UniProt Protein Name
CGG triplet repeat-binding protein 1
UniProt Gene Name
CGGBP1
UniProt Synonym Gene Names
CGGBP; CGG-binding protein 1
UniProt Entry Name
CGBP1_HUMAN

NCBI Description

This gene encodes a CGG repeat-binding protein that primarily localizes to the nucleus. CGG trinucleotide repeats are implicated in many disorders as they often act as transcription- and translation-regulatory elements, can produce hairpin structures which cause DNA replication errors, and form regions prone to chromosomal breakage. CGG repeats are also targets for CpG methylation. In addition to its ability to bind CGG repeats and regulate transcription, this gene is believed to play a role in DNA damage repair and telomere protection. In vitro studies indicate this protein does not bind to methylated CpG sequences. [provided by RefSeq, Jul 2017]

Uniprot Description

CGGBP1: Binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. May play a role in regulating FMR1 promoter.

Protein type: Transcription regulation

Chromosomal Location of Human Ortholog: 3p11.1

Cellular Component: nucleoplasm; nucleus

Molecular Function: double-stranded DNA binding

Biological Process: transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter

Research Articles on CGGBP1

Similar Products

Product Notes

The CGGBP1 cggbp1 (Catalog #AAA3216849) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CGGBP1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CGGBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CGGBP1 cggbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGKLFCTSCN VVLNHVRKSA ISDHLKSKTH TKRKAEFEEQ NVRKKQRPLT. It is sometimes possible for the material contained within the vial of "CGGBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.