Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CFHR1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Rabbit anti-Human, Rat CFHR1 Polyclonal Antibody | anti-CFHR1 antibody

CFHR1 antibody - N-terminal region

Gene Names
CFHR1; CFHL; FHR1; HFL1; HFL2; CFHL1; H36-1; H36-2; CFHL1P; CFHR1P
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CFHR1; Polyclonal Antibody; CFHR1 antibody - N-terminal region; anti-CFHR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS
Sequence Length
330
Applicable Applications for anti-CFHR1 antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CFHR1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Western Blot (WB) (WB Suggested Anti-CFHR1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-CFHR1 antibody
This is a rabbit polyclonal antibody against CFHR1. It was validated on Western Blot

Target Description: This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome.
Product Categories/Family for anti-CFHR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
complement factor H-related protein 1
NCBI Official Synonym Full Names
complement factor H related 1
NCBI Official Symbol
CFHR1
NCBI Official Synonym Symbols
CFHL; FHR1; HFL1; HFL2; CFHL1; H36-1; H36-2; CFHL1P; CFHR1P
NCBI Protein Information
complement factor H-related protein 1
UniProt Protein Name
Complement factor H-related protein 1
UniProt Gene Name
CFHR1
UniProt Synonym Gene Names
CFHL; CFHL1; CFHL1P; CFHR1P; FHR1; HFL1; HFL2; FHR-1; H-factor-like 1
UniProt Entry Name
FHR1_HUMAN

NCBI Description

This gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonas aeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed that Tuf acts as a virulence factor by acquiring host proteins to the pathogen surface, controlling complement, and facilitating tissue invasion. Mutations in this gene are associated with an increased risk of atypical hemolytic-uremic syndrome. [provided by RefSeq, Oct 2009]

Uniprot Description

CFHR1: Might be involved in complement regulation. Can associate with lipoproteins and may play a role in lipid metabolism.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: extracellular space

Biological Process: complement activation

Disease: Macular Degeneration, Age-related, 1; Hemolytic Uremic Syndrome, Atypical, Susceptibility To, 1

Research Articles on CFHR1

Similar Products

Product Notes

The CFHR1 cfhr1 (Catalog #AAA3215556) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CFHR1 antibody - N-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CFHR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CFHR1 cfhr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NHGILYDEEK YKPFSQVPTG EVFYYSCEYN FVSPSKSFWT RITCTEEGWS. It is sometimes possible for the material contained within the vial of "CFHR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.