Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CES2 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Rabbit anti-Human CES2 Polyclonal Antibody | anti-CES2 antibody

CES2 antibody - middle region

Gene Names
CES2; iCE; CE-2; PCE-2; CES2A1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CES2; Polyclonal Antibody; CES2 antibody - middle region; anti-CES2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEG
Sequence Length
607
Applicable Applications for anti-CES2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CES2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CES2 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-CES2 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Related Product Information for anti-CES2 antibody
This is a rabbit polyclonal antibody against CES2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific
Product Categories/Family for anti-CES2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
cocaine esterase isoform 2
NCBI Official Synonym Full Names
carboxylesterase 2
NCBI Official Symbol
CES2
NCBI Official Synonym Symbols
iCE; CE-2; PCE-2; CES2A1
NCBI Protein Information
cocaine esterase
UniProt Protein Name
Cocaine esterase
Protein Family
UniProt Gene Name
CES2
UniProt Synonym Gene Names
ICE; CE-2; hCE-2
UniProt Entry Name
EST2_HUMAN

NCBI Description

This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2010]

Uniprot Description

CES2: Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows high catalytic efficiency for hydrolysis of cocaine, 4-methylumbelliferyl acetate, heroin and 6-monoacetylmorphine. Belongs to the type-B carboxylesterase/lipase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.1.56; EC 3.1.1.84; Xenobiotic Metabolism - drug metabolism - other enzymes; Endoplasmic reticulum; EC 3.1.1.1; Hydrolase

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: extracellular space; endoplasmic reticulum; endoplasmic reticulum lumen

Molecular Function: methylumbelliferyl-acetate deacetylase activity

Biological Process: catabolic process

Research Articles on CES2

Similar Products

Product Notes

The CES2 ces2 (Catalog #AAA3206530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CES2 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CES2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CES2 ces2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QHQPSWLKNI RPPHMKADHV KFTEEEEQLS RKMMKYWANF ARNGNPNGEG. It is sometimes possible for the material contained within the vial of "CES2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.