Western Blot (WB)
(CES2 monoclonal antibody (M03), clone 4E3. Western Blot analysis of CES2 expression in HepG2 (Cat # L019V1).)
Mouse CES2 Monoclonal Antibody | anti-CES2 antibody
CES2 (Carboxylesterase 2 (intestine, liver), CE-2, CES2A1, PCE-2, iCE) (Biotin)
Gene Names
CES2; iCE; CE-2; PCE-2; CES2A1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
CES2; Monoclonal Antibody; CES2 (Carboxylesterase 2 (intestine; liver); CE-2; CES2A1; PCE-2; iCE) (Biotin); Carboxylesterase 2 (intestine; iCE; anti-CES2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4000
Specificity
Recognizes CES2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CES2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CES2 (NP_003860, 514aa-621aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(CES2 monoclonal antibody (M03), clone 4E3. Western Blot analysis of CES2 expression in HepG2 (Cat # L019V1).)
Western Blot (WB)
(CES2 monoclonal antibody (M03), clone 4E3. Western Blot analysis of CES2 expression in HepG2 (Cat # L019V1).)
Related Product Information for anti-CES2 antibody
Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq].
Product Categories/Family for anti-CES2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59,959 Da
NCBI Official Full Name
cocaine esterase isoform 1
NCBI Official Synonym Full Names
carboxylesterase 2
NCBI Official Symbol
CES2
NCBI Official Synonym Symbols
iCE; CE-2; PCE-2; CES2A1
NCBI Protein Information
cocaine esterase; carboxylesterase 2 (intestine, liver); hCE-2; intestinal carboxylesterase; liver carboxylesterase-2; methylumbelliferyl-acetate deacetylase 2
UniProt Protein Name
Cocaine esterase
Protein Family
UniProt Gene Name
CES2
UniProt Synonym Gene Names
ICE; CE-2; hCE-2
UniProt Entry Name
EST2_HUMAN
Uniprot Description
CES2: Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows high catalytic efficiency for hydrolysis of cocaine, 4-methylumbelliferyl acetate, heroin and 6-monoacetylmorphine. Belongs to the type-B carboxylesterase/lipase family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 3.1.1.56; EC 3.1.1.84; Xenobiotic Metabolism - drug metabolism - other enzymes; Endoplasmic reticulum; EC 3.1.1.1; Hydrolase
Chromosomal Location of Human Ortholog: 16q22.1
Cellular Component: extracellular space; endoplasmic reticulum; endoplasmic reticulum lumen
Molecular Function: methylumbelliferyl-acetate deacetylase activity
Biological Process: catabolic process
Similar Products
Product Notes
The CES2 ces2 (Catalog #AAA6172875) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CES2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CES2 ces2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CES2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
