Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of CEP68 using anti-CEP68 antibody (MBS1750701). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates,Lane 2: human COLO-320 whole cell lysates,Lane 3: human SK-OV-3 whole cell lysates,Lane 4: human Jurkat whole cell lysates,Lane 5: rat heart tissue lysates,Lane 6: mouse heart tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CEP68 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CEP68 at approximately 81KD. The expected band size for CEP68 is at 81KD. )

Rabbit CEP68 Polyclonal Antibody | anti-CEP68 antibody

Anti-CEP68 Picoband antibody

Gene Names
CEP68; KIAA0582
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Western Blot
Synonyms
CEP68; Polyclonal Antibody; Anti-CEP68 Picoband antibody; Centrosomal protein of 68 kDa; Cep68; KIAA0582; anti-CEP68 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Form/Format
Lyophilized
Sequence Length
620
Applicable Applications for anti-CEP68 antibody
Western Blot (WB)
Application Notes
WB: 0.1-0.5mug/ml
Immunogen
A synthetic peptide corresponding to a sequence of human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID).
Subcellular Localization
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of CEP68 using anti-CEP68 antibody (MBS1750701). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates,Lane 2: human COLO-320 whole cell lysates,Lane 3: human SK-OV-3 whole cell lysates,Lane 4: human Jurkat whole cell lysates,Lane 5: rat heart tissue lysates,Lane 6: mouse heart tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CEP68 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CEP68 at approximately 81KD. The expected band size for CEP68 is at 81KD. )

Western Blot (WB) (Figure 1. Western blot analysis of CEP68 using anti-CEP68 antibody (MBS1750701). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates,Lane 2: human COLO-320 whole cell lysates,Lane 3: human SK-OV-3 whole cell lysates,Lane 4: human Jurkat whole cell lysates,Lane 5: rat heart tissue lysates,Lane 6: mouse heart tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CEP68 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CEP68 at approximately 81KD. The expected band size for CEP68 is at 81KD. )
Related Product Information for anti-CEP68 antibody
Description: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and rootletin depend both on each other for centriole association, and both also require CEP250 for their function.
Protein Function: Involved in maintenance of centrosome cohesion, probably as part of a linker structure which prevents centrosome splitting (PubMed: 18042621). Required for localization of CDK5RAP2 to the centrosome during interphase (PubMed: 24554434, PubMed: 25503564).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,040 Da
NCBI Official Full Name
centrosomal protein of 68 kDa isoform a
NCBI Official Synonym Full Names
centrosomal protein 68
NCBI Official Symbol
CEP68
NCBI Official Synonym Symbols
KIAA0582
NCBI Protein Information
centrosomal protein of 68 kDa
UniProt Protein Name
Centrosomal protein of 68 kDa
Protein Family
UniProt Gene Name
CEP68
UniProt Synonym Gene Names
KIAA0582; Cep68

Uniprot Description

Involved in maintenance of centrosome cohesion, probably as part of a linker structure which prevents centrosome splitting (PubMed:18042621). Required for localization of CDK5RAP2 to the centrosome during interphase (PubMed:24554434, PubMed:25503564).

Research Articles on CEP68

Similar Products

Product Notes

The CEP68 cep68 (Catalog #AAA1750701) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CEP68 Picoband antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's CEP68 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.1-0.5mug/ml. Researchers should empirically determine the suitability of the CEP68 cep68 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CEP68, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.