Western Blot (WB)
(Host: RabbitTarget Name: CEBPZSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human CEBPZ Polyclonal Antibody | anti-CEBPZ antibody
CEBPZ Antibody-N-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CEBPZ; Polyclonal Antibody; CEBPZ Antibody-N-terminal region; CCAAT/enhancer-binding protein zeta; UBC; TARBP2; EED; RNF2; HDAC11; SIRT7; SUMO2; RELA; RPS6KA6; LAMTOR3; PRKRA; UBE3A; HMOX2; GSK3B; ZBTB7B; LZTR1; STAT6; RXRG; PCBD1; TP73; TP53; NFYB; LAG3; CBF; CBF2; NOC1; HSP-CBF; anti-CEBPZ antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGG
Applicable Applications for anti-CEBPZ antibody
Western Blot (WB)
Protein Size
1054 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CEBPZ
Predicted Homology Based on Immunogen Sequence
Cow: 77%; Horse: 80%; Human: 100%; Mouse: 80%; Pig: 77%; Rabbit: 85%; Rat: 82%; Yeast: 83%; Zebrafish: 83%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CEBPZSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CEBPZSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CEBPZ antibody
Description of Target: This gene belongs to the CEBP family. The encoded protein plays a role in cellular response to environmental stimuli through a transcriptional process that involves heat shock factors, conserved DNA elements (heat shock elements or HSEs) and CCAAT boxes. The protein acts as a DNA-binding transcriptional activator and regulates the heat-shock protein 70 (HSP70) promoter in a CCAAT-dependent manner. The protein is also involved in cell growth and differentiation, particularly, hematopoietic differentiation. Methylation of the promoter of this gene or mutations within the gene may be correlated with occurance of acute myeloid leukemia (AML).
NCBI and Uniprot Product Information
NCBI GeneID
Molecular Weight
115kDa
UniProt Protein Name
CCAAT/enhancer-binding protein zeta
Protein Family
UniProt Gene Name
CEBPZ
UniProt Synonym Gene Names
CBF2; CBF
UniProt Entry Name
CEBPZ_HUMAN
Uniprot Description
C/EBP-zeta: Stimulates transcription from the HSP70 promoter. Belongs to the CBF/MAK21 family.
Protein type: RNA-binding; Transcription factor
Chromosomal Location of Human Ortholog: 2p22.2
Cellular Component: nucleus
Molecular Function: DNA binding
Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter
Similar Products
Product Notes
The CEBPZ cebpz (Catalog #AAA3249598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEBPZ Antibody-N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEBPZ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEBPZ cebpz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAVKEPLEF HAKRPWRPEE AVEDPDEEDE DNTSEAENGF SLEEVLRLGG. It is sometimes possible for the material contained within the vial of "CEBPZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
