Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human CEACAM6 Monoclonal Antibody | anti-CEACAM6 antibody

CEACAM6 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 6, Non-specific Crossreacting Antigen, Normal Cross-reacting Antigen, CD66c, NCA) (HRP)

Gene Names
CEACAM6; NCA; CEAL; CD66c
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CEACAM6; Monoclonal Antibody; CEACAM6 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 6; Non-specific Crossreacting Antigen; Normal Cross-reacting Antigen; CD66c; NCA) (HRP); anti-CEACAM6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G2
Specificity
Recognizes human CEACAM6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CEACAM6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa156-265 from human CEACAM6 (NP_002474) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Testing Data

(Detection limit for recombinant GST tagged CEACAM6 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CEACAM6 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-CEACAM6 antibody
CEA-related cell adhesion molecule 6 (CEACAM6, NCA) belongs to the carcinoembryonic antigen (CEA) gene family. It encodes a glycosyl phosphatidyl inositol GPI)-linked glycoprotein with a Mr of 90kD which is strongly expressed on epithelial cells of the fetal and adult gastrointestinal tract, epithelia of glandular tissues, squamous epithelial cell of the tongue, esophagus and cervix as well as on granulocytes. CEACAM6 expression is upregulated in many adenocarcinomas and leukemias. Like all members of the CEA family, it consists of a single N domain, with structural homology to the immunoglobulin variable domains, followed by one immunoglobulin constant-like A and B domain.
Product Categories/Family for anti-CEACAM6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.6kDa (297aa) 40-57KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
carcinoembryonic antigen-related cell adhesion molecule 6 preproprotein
NCBI Official Synonym Full Names
carcinoembryonic antigen related cell adhesion molecule 6
NCBI Official Symbol
CEACAM6
NCBI Official Synonym Symbols
NCA; CEAL; CD66c
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 6
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 6
UniProt Gene Name
CEACAM6
UniProt Synonym Gene Names
NCA

NCBI Description

This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tumor markers in serum immunoassay determinations of carcinoma. This gene affects the sensitivity of tumor cells to adenovirus infection. The protein encoded by this gene acts as a receptor for adherent-invasive E. coli adhesion to the surface of ileal epithelial cells in patients with Crohn's disease. This gene is clustered with genes and pseudogenes of the cell adhesion molecules subgroup of the CEA family on chromosome 19. [provided by RefSeq, Apr 2014]

Uniprot Description

CEACAM6: a glycosylphosphatidylinositol(GPI)-linked glycoprotein implicated in a variety of human cancers. Expressed on epithelial cells of various tissues, especially colon, lung, pancreas, trachea, and bone marrow. Participates in innate immune defense, cell proliferation and differentiation. Expressed at high levels in gastrointestinal tract, pancreatic and lung tumors. CEACAM6 promotes tumor angiogenesis in gastric cancer. May enhance invasiveness and metastatic potential in gastric and pancreatic cancer by promoting EMT via PI3K/AKT signaling. Upregulated by the pro-inflammatory cytokine IL-6. Belongs to the immunoglobulin superfamily/CEA family.

Protein type: Membrane protein, GPI anchor; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: extracellular space; integral to plasma membrane; plasma membrane

Molecular Function: protein binding

Biological Process: cell-cell signaling; leukocyte migration; positive regulation of cell migration; positive regulation of cell proliferation; signal transduction

Research Articles on CEACAM6

Similar Products

Product Notes

The CEACAM6 ceacam6 (Catalog #AAA6151747) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CEACAM6 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 6, Non-specific Crossreacting Antigen, Normal Cross-reacting Antigen, CD66c, NCA) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEACAM6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CEACAM6 ceacam6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CEACAM6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.