Immunohistochemistry (IHC)
(HC Suggested Anti-CDT1 antibodyTitration:2 ug/mlPositive Control:Mouse brain stem cells)
Rabbit CDT1 Polyclonal Antibody | anti-CDT1 antibody
CDT1 antibody - C-terminal region
Gene Names
CDT1; DUP; RIS2
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CDT1; Polyclonal Antibody; CDT1 antibody - C-terminal region; anti-CDT1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ
Sequence Length
546
Applicable Applications for anti-CDT1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 77%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CDT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(HC Suggested Anti-CDT1 antibodyTitration:2 ug/mlPositive Control:Mouse brain stem cells)
Immunohistochemistry (IHC)
(HC Suggested Anti-CDT1 antibodyTitration:2 ug/mlPositive Control:Mouse brain stem cells)
Western Blot (WB)
(Sample Type: 3. rat brain extract (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience Secondary Antibody Dilution: 1: 20,000 Image Submitted by: Yuzhi Chen University of Arkansas for Medical Science)
Western Blot (WB)
(Sample Type: 3. rat brain extract (80ug) Primary Antibody Dilution: 2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience Secondary Antibody Dilution: 1: 20,000 Image Submitted by: Yuzhi Chen University of Arkansas for Medical Science)
Western Blot (WB)
(WB Suggested Anti-CDT1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-CDT1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-CDT1 antibody
This is a rabbit polyclonal antibody against CDT1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication. It binds DNA in a sequence-, strand-, and conformation-independent manner and is a potential oncogene.
Target Description: CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication. It binds DNA in a sequence-, strand-, and conformation-independent manner and is a potential oncogene.
Product Categories/Family for anti-CDT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
DNA replication factor Cdt1
NCBI Official Synonym Full Names
chromatin licensing and DNA replication factor 1
NCBI Official Symbol
CDT1
NCBI Official Synonym Symbols
DUP; RIS2
NCBI Protein Information
DNA replication factor Cdt1
UniProt Protein Name
DNA replication factor Cdt1
Protein Family
UniProt Gene Name
CDT1
UniProt Synonym Gene Names
DUP
UniProt Entry Name
CDT1_HUMAN
NCBI Description
The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to prevent this protein from initiating replication at inappropriate origins. Phosphorylation of this protein by cyclin A-dependent kinases results in degradation of the protein. [provided by RefSeq, Mar 2011]
Research Articles on CDT1
Similar Products
Product Notes
The CDT1 cdt1 (Catalog #AAA3208168) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDT1 antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's CDT1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CDT1 cdt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PATPPATPPA ASPSALKGVS QDLLERIRAK EAQKQLAQMT RCPEQEQRLQ. It is sometimes possible for the material contained within the vial of "CDT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
