Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of Cdk6 expression in rat pancreas extract (lane 1) and K562 whole cell lysates (lane 2). Cdk6 at 37KD was detected using rabbit anti- Cdk6 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit CDK6 Polyclonal Antibody | anti-CDK6 antibody

Anti-Cdk6 Antibody

Gene Names
CDK6; MCPH12; PLSTIRE
Reactivity
Human, Rat
No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
CDK6; Polyclonal Antibody; Anti-Cdk6 Antibody; CDKN6; PLSTIRE; STQTL11; Q00534 ; Cyclin-dependent kinase 6; cyclin-dependent kinase 6; anti-CDK6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
326
Applicable Applications for anti-CDK6 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat
Tested Species:In-house tested species with positive results.
Other applications have not been tested.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6 (119-150aa TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN), identical to the related mouse sequence.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Cdk6 expression in rat pancreas extract (lane 1) and K562 whole cell lysates (lane 2). Cdk6 at 37KD was detected using rabbit anti- Cdk6 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of Cdk6 expression in rat pancreas extract (lane 1) and K562 whole cell lysates (lane 2). Cdk6 at 37KD was detected using rabbit anti- Cdk6 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-CDK6 antibody
Rabbit IgG polyclonal antibody for Cyclin-dependent kinase 6 (CDK6) detection.
Background: Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene. The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21. Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition. This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation. It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types. In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans.
References
1. Lena, A. M., Mancini, M., Rivetti di Val Cervo, P. R., Saintigny, G., Mahe, C., Melino, G., Candi, E. MicroRNA-191 triggers keratinocytes senescence by SATB1 and CDK6 downregulation. Biochem. Biophys. Res. Commun. 423: 509-514, 2012.
2. Lien, H.-C., Lin, C.-W., Huang, P.-H., Chang, M.-L., Hsu, S.-M. Expression of cyclin-dependent kinase 6 (cdk6) and frequent loss of CD44 in nasal-nasopharyngeal NK/T-cell lymphomas: comparison with CD56-negative peripheral T-cell lymphomas. Lab. Invest. 80: 893-900, 2000.
3. Malumbres, M., Sotillo, R., Santamaria, D., Galan, J., Cerezo, A., Ortega, S., Dubus, P., Barbacid, M. Mammalian cells cycle without the D-type cyclin-dependent kinases Cdk4 and Cdk6. Cell 118: 493-504, 2004.
4. Veiga-Fernandes, H., Rocha, B. High expression of active CDK6 in the cytoplasm of CD8 memory cells favors rapid division. Nature Immun. 5: 31-37, 2003.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,938 Da
NCBI Official Full Name
cyclin-dependent kinase 6
NCBI Official Synonym Full Names
cyclin dependent kinase 6
NCBI Official Symbol
CDK6
NCBI Official Synonym Symbols
MCPH12; PLSTIRE
NCBI Protein Information
cyclin-dependent kinase 6
UniProt Protein Name
Cyclin-dependent kinase 6
Protein Family
UniProt Gene Name
CDK6
UniProt Synonym Gene Names
CDKN6
UniProt Entry Name
CDK6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Expression of this gene is up-regulated in some types of cancer. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2009]

Uniprot Description

CDK6: a protein kinase of the CDK family. Important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. Phosphorylates and regulates the activity of the Rb tumor suppressor protein. Overexpressed and/or disrupted by translocation in leukemias, lymphomas and other cancers and amplified in gliomas and rodent cancers.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.22; Protein kinase, CMGC; Cell cycle regulation; CMGC group; CDK family; CDK/CDK4 subfamily; CDK4 subfamily

Chromosomal Location of Human Ortholog: 7q21-q22

Cellular Component: centrosome; cyclin-dependent protein kinase holoenzyme complex; cytoplasm; cytosol; nucleoplasm; nucleus; ruffle

Molecular Function: ATP binding; cyclin binding; cyclin-dependent protein kinase activity; protein binding

Biological Process: astrocyte development; cell cycle arrest; cell dedifferentiation; dentate gyrus development; G1/S transition of mitotic cell cycle; generation of neurons; gliogenesis; lateral ventricle development; negative regulation of cell cycle; negative regulation of cell differentiation; negative regulation of cell proliferation; negative regulation of epithelial cell proliferation; negative regulation of myeloid cell differentiation; negative regulation of osteoblast differentiation; positive regulation of cell-matrix adhesion; positive regulation of fibroblast proliferation; protein amino acid phosphorylation; regulation of erythrocyte differentiation; regulation of gene expression; response to virus

Disease: Microcephaly 12, Primary, Autosomal Recessive

Research Articles on CDK6

Similar Products

Product Notes

The CDK6 cdk6 (Catalog #AAA178495) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Cdk6 Antibody reacts with Human, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's CDK6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat Tested Species:In-house tested species with positive results. Other applications have not been tested. Researchers should empirically determine the suitability of the CDK6 cdk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDK6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.