Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDCA8Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CDCA8 Polyclonal Antibody | anti-CDCA8 antibody

CDCA8 Antibody - middle region

Gene Names
CDCA8; BOR; DasraB; MESRGP; BOREALIN
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDCA8; Polyclonal Antibody; CDCA8 Antibody - middle region; anti-CDCA8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKP
Sequence Length
280
Applicable Applications for anti-CDCA8 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDCA8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDCA8Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDCA8Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CDCA8 antibody
This gene encodes a component of the chromosomal passenger complex. This complex is an essential regulator of mitosis and cell division. This protein is cell-cycle regulated and is required for chromatin-induced microtubule stabilization and spindle formation. Alternate splicing results in multiple transcript variants. Pseudgenes of this gene are found on chromosomes 7, 8 and 16.
Product Categories/Family for anti-CDCA8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
borealin
NCBI Official Synonym Full Names
cell division cycle associated 8
NCBI Official Symbol
CDCA8
NCBI Official Synonym Symbols
BOR; DasraB; MESRGP; BOREALIN
NCBI Protein Information
borealin
UniProt Protein Name
Borealin
UniProt Gene Name
CDCA8
UniProt Synonym Gene Names
PESCRG3; hDasra-B
UniProt Entry Name
BOREA_HUMAN

NCBI Description

This gene encodes a component of the chromosomal passenger complex. This complex is an essential regulator of mitosis and cell division. This protein is cell-cycle regulated and is required for chromatin-induced microtubule stabilization and spindle formation. Alternate splicing results in multiple transcript variants. Pseudgenes of this gene are found on chromosomes 7, 8 and 16. [provided by RefSeq, Apr 2013]

Uniprot Description

Borealin: Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. In the complex, it may be required to direct the CPC to centromeric DNA. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment. Belongs to the borealin family.

Protein type: Cell cycle regulation; Nucleolus

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: intercellular bridge; protein complex; nucleolus; spindle; midbody; nucleus; cytosol; chromosome, pericentric region; chromocenter

Molecular Function: protein binding

Biological Process: cell division; mitotic cell cycle; mitotic metaphase plate congression; chromosome organization and biogenesis

Research Articles on CDCA8

Similar Products

Product Notes

The CDCA8 cdca8 (Catalog #AAA3220841) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDCA8 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDCA8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDCA8 cdca8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNLQTARVKR CPPSKKRTQS IQGKGKGKRS SRANTVTPAV GRLEVSMVKP. It is sometimes possible for the material contained within the vial of "CDCA8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.