Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDC42EP3Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CDC42EP3 Polyclonal Antibody | anti-CDC42EP3 antibody

CDC42EP3 Antibody - middle region

Gene Names
CDC42EP3; UB1; CEP3; BORG2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDC42EP3; Polyclonal Antibody; CDC42EP3 Antibody - middle region; anti-CDC42EP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTG
Sequence Length
254
Applicable Applications for anti-CDC42EP3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDC42EP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDC42EP3Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDC42EP3Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDC42EP3 antibody
This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CDC42EP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27 kDa
NCBI Official Full Name
cdc42 effector protein 3
NCBI Official Synonym Full Names
CDC42 effector protein 3
NCBI Official Symbol
CDC42EP3
NCBI Official Synonym Symbols
UB1; CEP3; BORG2
NCBI Protein Information
cdc42 effector protein 3
UniProt Protein Name
Cdc42 effector protein 3
Protein Family
UniProt Gene Name
CDC42EP3
UniProt Synonym Gene Names
BORG2; CEP3
UniProt Entry Name
BORG2_HUMAN

NCBI Description

This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]

Uniprot Description

CDC42EP3: Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts. Belongs to the BORG/CEP family.

Protein type: G protein regulator, misc.

Chromosomal Location of Human Ortholog: 2p21

Cellular Component: cytoplasm; plasma membrane; endomembrane system; actin cytoskeleton

Molecular Function: GTP-Rho binding; cytoskeletal regulatory protein binding

Biological Process: regulation of cell shape; positive regulation of pseudopodium formation; positive regulation of actin filament polymerization; signal transduction; Rho protein signal transduction

Research Articles on CDC42EP3

Similar Products

Product Notes

The CDC42EP3 cdc42ep3 (Catalog #AAA3222777) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC42EP3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC42EP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDC42EP3 cdc42ep3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSSQGRDSHS SSLSEQYPDW PAEDMFDHPT PCELIKGKTK SEESLSDLTG. It is sometimes possible for the material contained within the vial of "CDC42EP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.