Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CDC42BPB AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellCDC42BPB is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit CDC42BPB Polyclonal Antibody | anti-CDC42BPB antibody

CDC42BPB Antibody - C-terminal region

Gene Names
CDC42BPB; MRCKB
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDC42BPB; Polyclonal Antibody; CDC42BPB Antibody - C-terminal region; anti-CDC42BPB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLKLPDFQDSIFEYFNTAPLAHDLTFRTSSASEQETQAPKPEASPSMSVA
Sequence Length
1711
Applicable Applications for anti-CDC42BPB antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDC42BPB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CDC42BPB AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellCDC42BPB is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-CDC42BPB AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellCDC42BPB is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-CDC42BPB antibody
This is a rabbit polyclonal antibody against CDC42BPB. It was validated on Western Blot

Target Description: This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization.
Product Categories/Family for anti-CDC42BPB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
194kDa
NCBI Official Full Name
serine/threonine-protein kinase MRCK beta
NCBI Official Synonym Full Names
CDC42 binding protein kinase beta
NCBI Official Symbol
CDC42BPB
NCBI Official Synonym Symbols
MRCKB
NCBI Protein Information
serine/threonine-protein kinase MRCK beta
UniProt Protein Name
Serine/threonine-protein kinase MRCK beta
UniProt Gene Name
CDC42BPB
UniProt Synonym Gene Names
KIAA1124; CDC42BP-beta; MRCK beta
UniProt Entry Name
MRCKB_HUMAN

NCBI Description

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein contains a Cdc42/Rac-binding p21 binding domain resembling that of PAK kinase. The kinase domain of this protein is most closely related to that of myotonic dystrophy kinase-related ROK. Studies of the similar gene in rat suggested that this kinase may act as a downstream effector of Cdc42 in cytoskeletal reorganization. [provided by RefSeq, Jul 2008]

Uniprot Description

MRCKB: Serine/threonine-protein kinase which is an important downstream effector of CDC42 and plays a role in the regulation of cytoskeleton reorganization and cell migration. Regulates actin cytoskeletal reorganization via phosphorylation of PPP1R12C and MYL9/MLC2. In concert with MYO18A and LURAP1, is involved in modulating lamellar actomyosin retrograde flow that is crucial to cell protrusion and migration. Phosphorylates PPP1R12A. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. DMPK subfamily.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, AGC; Kinase, protein; EC 2.7.11.1; AGC group; DMPK family; GEK subfamily

Chromosomal Location of Human Ortholog: 14q32.3

Cellular Component: cytoskeleton; cytoplasm; leading edge; plasma membrane; actomyosin; intercellular junction

Molecular Function: protein serine/threonine kinase activity; Rho GTPase binding; magnesium ion binding; ATP binding; protein kinase activity

Biological Process: cell migration; regulation of catalytic activity; actomyosin structure organization and biogenesis; actin cytoskeleton reorganization; establishment and/or maintenance of cell polarity; cytoskeleton organization and biogenesis; signal transduction; protein amino acid phosphorylation

Research Articles on CDC42BPB

Similar Products

Product Notes

The CDC42BPB cdc42bpb (Catalog #AAA3216777) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC42BPB Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDC42BPB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDC42BPB cdc42bpb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLKLPDFQDS IFEYFNTAPL AHDLTFRTSS ASEQETQAPK PEASPSMSVA. It is sometimes possible for the material contained within the vial of "CDC42BPB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.