Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Human Fetal heartCD9 antibody - N-terminal region validated by WB using Fetal Heart Lysate at 1.0ug/ml.)

Rabbit CD9 Polyclonal Antibody | anti-CD9 antibody

CD9 antibody - N-terminal region

Gene Names
CD9; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD9; Polyclonal Antibody; CD9 antibody - N-terminal region; anti-CD9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV
Sequence Length
228
Applicable Applications for anti-CD9 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 92%; Goat: 93%; Guinea Pig: 77%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 86%; Rat: 100%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CD9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Human Fetal heartCD9 antibody - N-terminal region validated by WB using Fetal Heart Lysate at 1.0ug/ml.)

Western Blot (WB) (Sample Type: Human Fetal heartCD9 antibody - N-terminal region validated by WB using Fetal Heart Lysate at 1.0ug/ml.)

Western Blot (WB)

(Sample Type: mouse fibroblast lusate (10ug)Primary Dilution: 1:2000 (1% BSA)Secondary Dilution: 1:2000 (5% milk)Image Submitted By:Anonymous researcher)

Western Blot (WB) (Sample Type: mouse fibroblast lusate (10ug)Primary Dilution: 1:2000 (1% BSA)Secondary Dilution: 1:2000 (5% milk)Image Submitted By:Anonymous researcher)
Related Product Information for anti-CD9 antibody
This is a rabbit polyclonal antibody against CD9. It was validated on Western Blot

Target Description: This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.
Product Categories/Family for anti-CD9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
928
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
CD9 antigen isoform 1
NCBI Official Synonym Full Names
CD9 molecule
NCBI Official Symbol
CD9
NCBI Official Synonym Symbols
MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
NCBI Protein Information
CD9 antigen
UniProt Protein Name
CD9 antigen
Protein Family
UniProt Gene Name
CD9
UniProt Synonym Gene Names
MIC3; TSPAN29; MRP-1; Tspan-29
UniProt Entry Name
CD9_HUMAN

NCBI Description

This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]

Uniprot Description

CD9: Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion. Belongs to the tetraspanin (TM4SF) family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: extracellular space; platelet alpha granule membrane; focal adhesion; integral to plasma membrane; apical plasma membrane; plasma membrane; vesicle; external side of plasma membrane

Molecular Function: integrin binding; protein binding

Biological Process: negative regulation of cell proliferation; platelet activation; platelet degranulation; fusion of sperm to egg plasma membrane; single fertilization; pathogenesis; brain development; cell adhesion; cell motility; blood coagulation; oligodendrocyte development; response to water deprivation; multicellular organism reproduction; paranodal junction assembly

Research Articles on CD9

Similar Products

Product Notes

The CD9 cd9 (Catalog #AAA3215111) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD9 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CD9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD9 cd9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KYLLFGFNFI FWLAGIAVLA IGLWLRFDSQ TKSIFEQETN NNNSSFYTGV. It is sometimes possible for the material contained within the vial of "CD9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.