Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CD79A expression in transfected 293T cell line by CD79A polyclonal antibody. Lane 1: CD79A transfected lysate (25kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CD79a Polyclonal Antibody | anti-CD79a antibody

CD79a (B Cell Antigen Receptor Complex-associated Protein alpha Chain, Ig-alpha, MB-1 Membrane Glycoprotein, Membrane-bound Immunoglobulin-associated Protein, Surface IgM-associated Protein, IGA, MB1) APC

Gene Names
CD79A; IGA; MB-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD79a; Polyclonal Antibody; CD79a (B Cell Antigen Receptor Complex-associated Protein alpha Chain; Ig-alpha; MB-1 Membrane Glycoprotein; Membrane-bound Immunoglobulin-associated Protein; Surface IgM-associated Protein; IGA; MB1) APC; anti-CD79a antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD79A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CD79a antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD79A, aa1-226 (NP_001774.1).
Immunogen Sequence
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD79A expression in transfected 293T cell line by CD79A polyclonal antibody. Lane 1: CD79A transfected lysate (25kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD79A expression in transfected 293T cell line by CD79A polyclonal antibody. Lane 1: CD79A transfected lysate (25kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CD79a antibody
CD79a, a 32-33KD membrane glycoprotein, is a member of Ig superfamily. It heterodimerizes with CD79b and is non-covalently cross-linked with surface Ig thus forming the BCR complex. It is expressed all stages of differentiation in mature B-cells and is required for cell surface expression and signal transduction by the BCR complex. Upon antigen binding, CD79a/b heterodimer interacts with Tyrosine kinase (Lyn) and gets phosphorylated, resulting in the inititation of intracellular signaling cascade. Pathological role of CD79a has been suggested in B-cell lymphomas and acute lymphoblastic leukemia. CD79a is often used along with CD20 in the detection of normal and neoplastic B-cells in tissue sections.
Product Categories/Family for anti-CD79a antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
973
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,038 Da
NCBI Official Full Name
B-cell antigen receptor complex-associated protein alpha chain isoform 1
NCBI Official Synonym Full Names
CD79a molecule, immunoglobulin-associated alpha
NCBI Official Symbol
CD79A
NCBI Official Synonym Symbols
IGA; MB-1
NCBI Protein Information
B-cell antigen receptor complex-associated protein alpha chain; ig-alpha; MB-1 membrane glycoprotein; surface IgM-associated protein; CD79a antigen (immunoglobulin-associated alpha); membrane-bound immunoglobulin-associated protein
UniProt Protein Name
B-cell antigen receptor complex-associated protein alpha chain
UniProt Gene Name
CD79A
UniProt Synonym Gene Names
IGA; MB1
UniProt Entry Name
CD79A_HUMAN

NCBI Description

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

Ig-alpha: an integral membrane protein that associates with surface immunoglobulin B lymphocyte antigen receptor multimeric complex. Surface Ig non-covalently associates with 2 other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. Two alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: multivesicular body; integral to membrane; plasma membrane; B cell receptor complex; lipid raft; external side of plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: B cell proliferation; B cell receptor signaling pathway; B cell activation; B cell differentiation

Disease: Agammaglobulinemia 3, Autosomal Recessive

Research Articles on CD79a

Similar Products

Product Notes

The CD79a cd79a (Catalog #AAA6373269) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD79a (B Cell Antigen Receptor Complex-associated Protein alpha Chain, Ig-alpha, MB-1 Membrane Glycoprotein, Membrane-bound Immunoglobulin-associated Protein, Surface IgM-associated Protein, IGA, MB1) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD79a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD79a cd79a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD79a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.