Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CD55Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CD55 Polyclonal Antibody | anti-CD55 antibody

CD55 Antibody-middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD55; Polyclonal Antibody; CD55 Antibody-middle region; Complement decay-accelerating factor; CR; TC; DAF; CROM; CHAPLE; anti-CD55 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
GEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVS
Applicable Applications for anti-CD55 antibody
Western Blot (WB)
Protein Size
381 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CD55
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CD55Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CD55Sample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CD55 antibody
Description of Target: This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
41kDa
UniProt Protein Name
Complement decay-accelerating factor
UniProt Gene Name
CD55
UniProt Synonym Gene Names
CR; DAF
UniProt Entry Name
DAF_HUMAN

Uniprot Description

CD55: This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Belongs to the receptors of complement activation (RCA) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Cell surface

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: cell surface; integral to plasma membrane; extracellular region; plasma membrane; lipid raft

Molecular Function: viral receptor activity; protein binding; lipid binding

Biological Process: respiratory burst; entry of virus into host cell; elevation of cytosolic calcium ion concentration; negative regulation of complement activation; regulation of complement activation; innate immune response; regulation of lipopolysaccharide-mediated signaling pathway; complement activation, classical pathway

Disease: Blood Group, Cromer System

Similar Products

Product Notes

The CD55 cd55 (Catalog #AAA3249907) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD55 Antibody-middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD55 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD55 cd55 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GEHSIYCTVN NDEGEWSGPP PECRGKSLTS KVPPTVQKPT TVNVPTTEVS. It is sometimes possible for the material contained within the vial of "CD55, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.