Rabbit anti-Human, Mouse CD3D Polyclonal Antibody | anti-CD3D antibody

CD3D (T-cell Surface Glycoprotein CD3 delta Chain, T-cell Receptor T3 delta Chain, CD3d, T3D) APC

Cat. Num. AAA6373060

• Gene Names: CD3D; T3D; IMD19; CD3-DELTA
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD3D; Polyclonal Antibody; CD3D (T-cell Surface Glycoprotein CD3 delta Chain; T-cell Receptor T3 delta Chain; CD3d; T3D) APC; anti-CD3D antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CD3D. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CD3D antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CD3D, aa1-171 (NP_000723.1).
• Immunogen Sequence: MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CD3D rabbit polyclonal antibody. Western Blot analysis of CD3D expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of CD3D expression in transfected 293T cell line by CD3D polyclonal antibody. Lane 1: CD3D transfected lysate (18.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CD3D and CANX. HeLa cells were stained with CD3D rabbit purified polyclonal 1:1200 and CANX mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Product Categories/Family for anti-CD3D antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4502669
• NCBI GeneID: 915
• NCBI Accession #: NP_000723.1
• NCBI GenBank Nucleotide #: NM_000732
• Molecular Weight: 14,484 Da
• NCBI Official Full Name: T-cell surface glycoprotein CD3 delta chain isoform A
• NCBI Official Synonym Full Names: CD3d molecule
• NCBI Official Symbol: CD3D
• NCBI Official Synonym Symbols: T3D; IMD19; CD3-DELTA
• NCBI Protein Information: T-cell surface glycoprotein CD3 delta chain
• Protein Family: T-cell surface glycoprotein

NCBI Description

The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq, Feb 2009]