Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD38 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit anti-Human CD38 Polyclonal Antibody | anti-CD38 antibody

CD38 antibody - C-terminal region

Gene Names
CD38; ADPRC1; ADPRC 1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD38; Polyclonal Antibody; CD38 antibody - C-terminal region; anti-CD38 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
Sequence Length
300
Applicable Applications for anti-CD38 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CD38
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD38 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CD38 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-CD38 antibody
This is a rabbit polyclonal antibody against CD38. It was validated on Western Blot

Target Description: CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
952
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
NCBI Official Synonym Full Names
CD38 molecule
NCBI Official Symbol
CD38
NCBI Official Synonym Symbols
ADPRC1; ADPRC 1
NCBI Protein Information
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
UniProt Protein Name
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
UniProt Gene Name
CD38
UniProt Synonym Gene Names
ADPRC 1; cADPr hydrolase 1
UniProt Entry Name
CD38_HUMAN

NCBI Description

The protein encoded by this gene is a non-lineage-restricted, type II transmembrane glycoprotein that synthesizes and hydrolyzes cyclic adenosine 5'-diphosphate-ribose, an intracellular calcium ion mobilizing messenger. The release of soluble protein and the ability of membrane-bound protein to become internalized indicate both extracellular and intracellular functions for the protein. This protein has an N-terminal cytoplasmic tail, a single membrane-spanning domain, and a C-terminal extracellular region with four N-glycosylation sites. Crystal structure analysis demonstrates that the functional molecule is a dimer, with the central portion containing the catalytic site. It is used as a prognostic marker for patients with chronic lymphocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

CD38: Synthesizes cyclic ADP-ribose, a second messenger for glucose-induced insulin secretion. Also has cADPr hydrolase activity. Also moonlights as a receptor in cells of the immune system. Belongs to the ADP-ribosyl cyclase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.2.2.6; EC 2.4.99.20; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; Hydrolase; Cell surface; Apoptosis; Lyase; Membrane protein, integral; Cell cycle regulation

Chromosomal Location of Human Ortholog: 4p15

Cellular Component: cell surface; membrane; integral to membrane; plasma membrane; nucleus

Molecular Function: transferase activity; phosphorus-oxygen lyase activity; NAD+ nucleosidase activity; NAD(P)+ nucleosidase activity

Biological Process: response to drug; response to retinoic acid; metabolic process; positive regulation of transcription, DNA-dependent; positive regulation of insulin secretion; female pregnancy; signal transduction; positive regulation of cell growth; response to estradiol stimulus; B cell receptor signaling pathway; elevation of cytosolic calcium ion concentration; response to hydroperoxide; positive regulation of B cell proliferation; positive regulation of vasoconstriction; response to hypoxia; response to progesterone stimulus; negative regulation of transcription, DNA-dependent; negative regulation of bone resorption; negative regulation of apoptosis

Research Articles on CD38

Similar Products

Product Notes

The CD38 cd38 (Catalog #AAA3214184) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD38 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD38 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD38 cd38 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RDLCQDPTIK ELESIISKRN IQFSCKNIYR PDKFLQCVKN PEDSSCTSEI. It is sometimes possible for the material contained within the vial of "CD38, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.