Rabbit CD33 Polyclonal Antibody | anti-CD33 antibody

Anti-CD33 Antibody IHC-plus

Cat. Num. AAA2400395

• Gene Names: CD33; p67; SIGLEC3; SIGLEC-3
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: CD33; Polyclonal Antibody; Anti-CD33 Antibody IHC-plus; CD33 antigen; CD33 molecule; gp67; SIGLEC-3; p67; CD33 antigen (gp67); SIGLEC3; anti-CD33 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Human CD33
• Purity/Purification: Affinity Purified
• Form/Format: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Concentration: 3.39 mg/ml (varies by lot)
• Sequence: YYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

• Applicable Applications for anti-CD33 antibody: Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB)
• Application Notes: IHC (1:50-1:200); IHC-Paraffin (1:200); Western Blot (1:500-1:2000); Optimal dilution to be determined by the researcher.
• Family / Subfamily: Immunoglobulin / not assigned-Immunoglobulin
• Host Note: CD33 antibody was produced in Rabbit
• Immunogen Species: CD33 antibody was raised against Human
• Immunogen: CD33 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 49-259 of human CD33 (NP_001763.3).
• Disclaimer: Due to the highly specific nature of antibodies and antigens, we cannot predict or be held responsible with respect to how this antibody will behave in your systems. Researchers using this antibody should conduct optimization studies to achieve the most optimal result possible for their intended application.
• Recommended Immunohistochemistry Protocol: The following protocol is a recommendation only, and MyBioSource, Inc. makes no guarantee of the results:; ; Tissue Preparation: ; Formalin fixation and embedding in paraffin wax. ; ; Tissue Sectioning: ; Make 4-um sections and place on pre-cleaned and charged microscope slides. Heat in a tissue-dryingoven for 45 minutes at 60°C. ; ; Deparaffinization: ; Wash dry slides in 3 changes of xylene - 5 minutes each @ RT; ; Rehydration: ; Wash slides in 3 changes of 100% alcohol - 3 minutes each @ RT; Wash slides in 2 changes of 95% alcohol - 3 minutes each @ RT; Wash slides in 1 change of 80% alcohol - 3 minutes @ RT; Rinse slides in gentle running distilled water - 5 minutes @ RT; ; Antigen retrieval: ; Steam slides in 0.01 M sodium citrate buffer, pH 6.0 at 99-100°C - 20 minutes; Remove from heat and let stand at room temperature in buffer - 20 minutes; Rinse in 1X TBS with Tween (TBST) -1 minute @ RT; ; Immunostaining: ; (Do not allow tissues to dry at any time during the staining procedure) ; Apply a universal protein block - 20 minutes @ RT; Drain protein block from slides, apply diluted primary antibody - 45 minutes @ RT; Rinse slides in 1 X TBST - 1 minute @ RT; Apply a biotinylated secondary antibody appropriate for the primary antibody - 30 minutes @ RT; Rinse slides in 1X TBST -1 minute @ RT; Apply alkaline phosphatase streptavidin - 30 minutes @ RT; Rinse slides in 1X TBST -1 minute @ RT; Apply alkaline phosphatase chromogen substrate - 30 minutes @ RT; Wash slides in distilled water - 1 minute @ RT; ; Dehydrate: ; (This method should only be used if the chromogen substrate is alcohol insoluble (e.g. Vector Red, DAB) ; Wash slides in 2 changes of 80% alcohol - 1 minute each @ RT; Wash slides in 2 changes of 95% alcohol - 1 minute each @ RT; Wash slides in 3 changes of 100% alcohol - 1 minute each @ RT; Wash slides in 3 changes of xylene - 1 minute each @ RT; Apply coverslip
• Preparation and Storage: Store at -20°C. Avoid freeze-thaw cycles.

NCBI and Uniprot Product Information

• NCBI GI #: 130979981
• NCBI GeneID: 945
• NCBI Accession #: NP_001763.3
• NCBI GenBank Nucleotide #: NM_001772.3
• UniProt Accession #: P20138; Q8TD24; B4E3P8; C9JEN7; F8WAL2
• Molecular Weight: Predicted MW: 25kDa/33kDa/39kDa; Observed MW: 67kDa (by Western Blot)
• NCBI Official Full Name: myeloid cell surface antigen CD33 isoform 1
• NCBI Official Synonym Full Names: CD33 molecule
• NCBI Official Symbol: CD33
• NCBI Official Synonym Symbols: p67; SIGLEC3; SIGLEC-3
• NCBI Protein Information: myeloid cell surface antigen CD33
• UniProt Protein Name: Myeloid cell surface antigen CD33
• Protein Family: Myeloid cell surface antigen
• UniProt Gene Name: CD33
• UniProt Synonym Gene Names: SIGLEC3; Siglec-3
• UniProt Entry Name: CD33_HUMAN

Uniprot Description

CD33: Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro). Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: external side of plasma membrane; integral to plasma membrane; plasma membrane

Molecular Function: carbohydrate binding; protein binding; receptor activity

Biological Process: cell adhesion; cell-cell signaling; negative regulation of cell proliferation; regulation of immune response; signal transduction