Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CD2B2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CD2BP2 Polyclonal Antibody | anti-CD2BP2 antibody

CD2BP2 Antibody - C-terminal region

Gene Names
CD2BP2; LIN1; Snu40; FWP010; U5-52K; PPP1R59
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CD2BP2; Polyclonal Antibody; CD2BP2 Antibody - C-terminal region; anti-CD2BP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Sequence Length
341
Applicable Applications for anti-CD2BP2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD2B2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CD2B2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CD2B2Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CD2BP2 antibody
This is a rabbit polyclonal antibody against CD2B2. It was validated on Western Blot

Target Description: This gene encodes a bi-functional protein. In the cytoplasm, the encoded protein binds the cytoplasmic tail of human surface antigen CD2 via its C-terminal GYF domain, and regulate CD2-triggered T lymphocyte activation. In the nucleus, this protein is a component of the U5 small nuclear ribonucleoprotein complex and is involved in RNA splicing. A pseudogene has been identified on chromosome 7. Alternative splicing results in multiple transcript variants but their biological validity has not been determined.
Product Categories/Family for anti-CD2BP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
CD2 antigen cytoplasmic tail-binding protein 2
NCBI Official Synonym Full Names
CD2 cytoplasmic tail binding protein 2
NCBI Official Symbol
CD2BP2
NCBI Official Synonym Symbols
LIN1; Snu40; FWP010; U5-52K; PPP1R59
NCBI Protein Information
CD2 antigen cytoplasmic tail-binding protein 2
UniProt Protein Name
CD2 antigen cytoplasmic tail-binding protein 2
UniProt Gene Name
CD2BP2
UniProt Synonym Gene Names
KIAA1178; CD2 cytoplasmic domain-binding protein 2; CD2 tail-binding protein 2; U5-52K
UniProt Entry Name
CD2B2_HUMAN

NCBI Description

This gene encodes a bi-functional protein. In the cytoplasm, the encoded protein binds the cytoplasmic tail of human surface antigen CD2 via its C-terminal GYF domain, and regulate CD2-triggered T lymphocyte activation. In the nucleus, this protein is a component of the U5 small nuclear ribonucleoprotein complex and is involved in RNA splicing. A pseudogene has been identified on chromosome 7. Alternative splicing results in multiple transcript variants but their biological validity has not been determined. [provided by RefSeq, Nov 2008]

Uniprot Description

CD2BP2: Binds the cytoplasmic domain of CD2 through the GYF domain.

Protein type: RNA processing; Spliceosome; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: nucleoplasm; U4/U6 x U5 tri-snRNP complex; snRNP U5; cytoplasm; nuclear speck; nucleus

Molecular Function: ribonucleoprotein binding; protein binding

Biological Process: assembly of spliceosomal tri-snRNP; nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression

Research Articles on CD2BP2

Similar Products

Product Notes

The CD2BP2 cd2bp2 (Catalog #AAA3219993) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD2BP2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD2BP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD2BP2 cd2bp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DAELYGPFTS AQMQTWVSEG YFPDGVYCRK LDPPGGQFYN SKRIDFDLYT. It is sometimes possible for the material contained within the vial of "CD2BP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.