Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- CD26 Picoband antibody, MBS177941, Western blottingAll lanes: Anti CD26 (MBS177941) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: 22RV1 Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugPredicted bind size: 88KDObserved bind size: 88KD )

anti-Human, Rat CD26 Polyclonal Antibody | anti-CD26 antibody

Anti-CD26 Antibody

Gene Names
DPP4; CD26; ADABP; ADCP2; DPPIV; TP103
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
CD26; Polyclonal Antibody; Anti-CD26 Antibody; Dipeptidyl peptidase 4; CD26 antigen; ADA-binding protein; ADABP; ADCP 2; ADCP-2; ADCP2; Adenosine deaminase complexing protein 2; CD 26; CD26 antigen 3; Dipeptidyl peptidase 4 soluble form; Dipeptidyl peptidase IV; Dipeptidyl peptidase IV membrane form; Dipeptidyl peptidase IV soluble form; Dipeptidyl peptidase; intestinal; Dipeptidylpeptidase 4; Dipeptidylpeptidase IV (CD26; adenosine deaminase complexing protein 2); Dipeptidylpeptidase IV; DPP 4; DPP IV; DPP IV estoenzyme; DPP4; DPP4_HUMAN; DPPIV; Intestinal dipeptidyl peptidase; T cell activation antigen CD26; T-cell activation antigen CD26; TP 103; TP103; dipeptidyl-peptidase 4; anti-CD26 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
766
Applicable Applications for anti-CD26 antibody
Western Blot (WB)
Application Notes
Western Blot

Concentration: 0.1-0.5ug/ml
Tested Species: Human, Rat


Tested Species: In-house tested species with positive results.

Other applications have not been tested.

Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731-761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ), different from the related mouse and rat sequences by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- CD26 Picoband antibody, MBS177941, Western blottingAll lanes: Anti CD26 (MBS177941) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: 22RV1 Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugPredicted bind size: 88KDObserved bind size: 88KD )

Western Blot (WB) (Anti- CD26 Picoband antibody, MBS177941, Western blottingAll lanes: Anti CD26 (MBS177941) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: 22RV1 Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugPredicted bind size: 88KDObserved bind size: 88KD )
Related Product Information for anti-CD26 antibody
Description: Rabbit IgG polyclonal antibody for Dipeptidyl peptidase 4(DPP4) detection. Tested with WB in Human;Rat.

Background: Dipeptidyl peptidase-4 (DPP4), also known as CD26 (cluster of differentiation 26) is a protein that, in humans, is encoded by the DPP4 gene. The protein encoded by the DPP4 gene is an antigenic enzyme expressed on the surface of most cell types and is associated with immune regulation, signal transduction and apoptosis. Also, it is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. DPP4 plays a major role in glucose metabolism. It is responsible for the degradation ofincretins such as GLP-1. Furthermore, it appears to work as a suppressor in the development of cancer andtumours.
References
1. Barnett A (Nov 2006). "DPP-4 inhibitors and their potential role in the management of type 2 diabetes".International Journal of Clinical Practice60 (11): 1454-70. 2. Kameoka J, Tanaka T, Nojima Y, Schlossman SF, Morimoto C (Jul 1993). "Direct association of adenosine deaminase with a T cell activation antigen, CD26".Science 261 (5120): 466-9. 3. Pro B, Dang NH (Oct 2004). "CD26/dipeptidyl peptidase IV and its role in cancer". Histology and Histopathology 19 (4): 1345-51.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88,279 Da
NCBI Official Full Name
dipeptidyl peptidase 4
NCBI Official Synonym Full Names
dipeptidyl peptidase 4
NCBI Official Symbol
DPP4
NCBI Official Synonym Symbols
CD26; ADABP; ADCP2; DPPIV; TP103
NCBI Protein Information
dipeptidyl peptidase 4
UniProt Protein Name
Dipeptidyl peptidase 4
UniProt Gene Name
DPP4
UniProt Synonym Gene Names
ADCP2; CD26; ADCP-2; DPP IV
UniProt Entry Name
DPP4_HUMAN

NCBI Description

The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. [provided by RefSeq, Jul 2008]

Uniprot Description

DPP4: Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF- kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. Belongs to the peptidase S9B family. DPPIV subfamily.

Protein type: Protease; Cell surface; Cell adhesion; EC 3.4.14.5; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q24.3

Cellular Component: apical plasma membrane; cell surface; endocytic vesicle; focal adhesion; integral to membrane; intercellular canaliculus; lamellipodium; lipid raft; lysosomal membrane; membrane; plasma membrane

Molecular Function: dipeptidyl-peptidase activity; identical protein binding; protease binding; protein binding; protein homodimerization activity; receptor binding; serine-type endopeptidase activity; serine-type peptidase activity; viral receptor activity

Biological Process: behavioral fear response; endothelial cell migration; entry of virus into host cell; positive regulation of cell proliferation; proteolysis; regulation of cell-cell adhesion mediated by integrin; response to hypoxia; T cell activation; T cell costimulation

Research Articles on CD26

Similar Products

Product Notes

The CD26 dpp4 (Catalog #AAA177941) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-CD26 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD26 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml Tested Species: Human, Rat Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the CD26 dpp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.