Western Blot (WB)
(Host: RabbitTarget Name: CD209BSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse CD209B Polyclonal Antibody | anti-CD209B antibody
CD209B Antibody - middle region
Gene Names
Cd209b; OtB7; SIGNR1; mSIGNR1; DC-SIGNR1; 1810030I22Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CD209B; Polyclonal Antibody; CD209B Antibody - middle region; anti-CD209B antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKC
Sequence Length
325
Applicable Applications for anti-CD209B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of mouse CD209B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CD209BSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CD209BSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CD209B antibody
Probable pathogen-recognition receptor. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. May recognize in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates.
Product Categories/Family for anti-CD209B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
CD209 antigen-like protein B isoform b
NCBI Official Synonym Full Names
CD209b antigen
NCBI Official Symbol
Cd209b
NCBI Official Synonym Symbols
OtB7; SIGNR1; mSIGNR1; DC-SIGNR1; 1810030I22Rik
NCBI Protein Information
CD209 antigen-like protein B
UniProt Protein Name
CD209 antigen-like protein B
Protein Family
UniProt Gene Name
Cd209b
UniProt Synonym Gene Names
DC-SIGNR1
UniProt Entry Name
C209B_MOUSE
Uniprot Description
CD209B: Probable pathogen-recognition receptor. May mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. May recognize in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens. Is a receptor for ICAM3, probably by binding to mannose-like carbohydrates. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Cellular Component: membrane; integral to membrane; external side of plasma membrane
Molecular Function: mannose binding; metal ion binding; zymosan binding; carbohydrate binding; polysaccharide binding
Biological Process: positive regulation of tumor necrosis factor biosynthetic process; detection of bacterium; positive regulation of phagocytosis; endocytosis; phagocytosis, recognition; detection of yeast
Research Articles on CD209B
Similar Products
Product Notes
The CD209B cd209b (Catalog #AAA3223790) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD209B Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD209B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD209B cd209b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLKKEATWLW VDGSTLSSRF QKYWNRGEPN NIGEEDCVEF AGDGWNDSKC. It is sometimes possible for the material contained within the vial of "CD209B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
