Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CD209 rabbit polyclonal antibody. Western Blot analysis of CD209 expression in human liver.)

Rabbit anti-Human, Mouse CD209 Polyclonal Antibody | anti-CD209 antibody

CD209 (CD209 Antigen, C-type Lectin Domain Family 4 Member L, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 1, DC-SIGN, DC-SIGN1, CLEC4L, MGC129965) (AP)

Gene Names
CD209; CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CD209; Polyclonal Antibody; CD209 (CD209 Antigen; C-type Lectin Domain Family 4 Member L; Dendritic Cell-specific ICAM-3-grabbing Non-integrin 1; DC-SIGN; DC-SIGN1; CLEC4L; MGC129965) (AP); anti-CD209 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD209. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CD209 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CD209, aa1-404 (NP_066978.1).
Immunogen Sequence
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CD209 rabbit polyclonal antibody. Western Blot analysis of CD209 expression in human liver.)

Western Blot (WB) (CD209 rabbit polyclonal antibody. Western Blot analysis of CD209 expression in human liver.)

Western Blot (WB)

(CD209 rabbit polyclonal antibody. Western Blot analysis of CD209 expression in mouse liver.)

Western Blot (WB) (CD209 rabbit polyclonal antibody. Western Blot analysis of CD209 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of CD209 expression in transfected 293T cell line by CD209 polyclonal antibody. Lane 1: CD209 transfected lysate (45.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD209 expression in transfected 293T cell line by CD209 polyclonal antibody. Lane 1: CD209 transfected lysate (45.8kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-CD209 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,874 Da
NCBI Official Full Name
CD209 antigen isoform 1
NCBI Official Synonym Full Names
CD209 molecule
NCBI Official Symbol
CD209
NCBI Official Synonym Symbols
CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1
NCBI Protein Information
CD209 antigen; HIV gpl20-binding protein; C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing n
UniProt Protein Name
CD209 antigen
Protein Family
UniProt Gene Name
CD209
UniProt Synonym Gene Names
CLEC4L; DC-SIGN; DC-SIGN1
UniProt Entry Name
CD209_HUMAN

NCBI Description

This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.[provided by RefSeq, Feb 2009]

Uniprot Description

CD209: Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, cytomegalovirus gB, HCV E2, dengue virus gE, Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri- mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA. Homotetramer. Binds to many viral surface glycoproteins such as HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus envelope glycoproteins, cytomegalovirus gB, HCV E2 and dengue virus major envelope protein E. Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes. 13 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: cell surface; membrane; cytoplasm; integral to membrane; plasma membrane

Molecular Function: mannose binding; protein binding; peptide antigen binding; metal ion binding; virion binding; carbohydrate binding

Biological Process: cell-cell recognition; heterophilic cell adhesion; antigen processing and presentation; leukocyte adhesion; virus-host interaction; regulation of T cell proliferation; innate immune response; peptide antigen transport; endocytosis; viral genome replication; virion attachment to host cell surface receptor

Disease: Mycobacterium Tuberculosis, Susceptibility To; Human Immunodeficiency Virus Type 1, Susceptibility To

Research Articles on CD209

Similar Products

Product Notes

The CD209 cd209 (Catalog #AAA6372938) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD209 (CD209 Antigen, C-type Lectin Domain Family 4 Member L, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 1, DC-SIGN, DC-SIGN1, CLEC4L, MGC129965) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD209 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD209 cd209 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD209, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.