Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CD207 rabbit polyclonal antibody. Western Blot analysis of CD207 expression in mouse lung.)

Rabbit anti-Human, Mouse CD207 Polyclonal Antibody | anti-CD207 antibody

CD207 (C-type Lectin Domain Family 4 Member K, Langerin, CLEC4K)

Gene Names
CD207; CLEC4K
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CD207; Polyclonal Antibody; CD207 (C-type Lectin Domain Family 4 Member K; Langerin; CLEC4K); Anti -CD207 (C-type Lectin Domain Family 4 Member K; anti-CD207 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CD207. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Applicable Applications for anti-CD207 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CD207, aa1-199 (AAH22278.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CD207 rabbit polyclonal antibody. Western Blot analysis of CD207 expression in mouse lung.)

Western Blot (WB) (CD207 rabbit polyclonal antibody. Western Blot analysis of CD207 expression in mouse lung.)

Western Blot (WB)

(Western Blot analysis of CD207 expression in transfected 293T cell line by CD207 polyclonal antibody. Lane 1: CD207 transfected lysate (36.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CD207 expression in transfected 293T cell line by CD207 polyclonal antibody. Lane 1: CD207 transfected lysate (36.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CD207 antibody
Langerin is a type II transmembrane protein with a single extracellular C-type lectin domain. It is a Langerhans cell restricted protein that plays a role as an endocytic receptor.
Product Categories/Family for anti-CD207 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,725 Da
NCBI Official Full Name
C-type lectin domain family 4 member K
NCBI Official Synonym Full Names
CD207 molecule, langerin
NCBI Official Symbol
CD207
NCBI Official Synonym Symbols
CLEC4K
NCBI Protein Information
C-type lectin domain family 4 member K; CD207 antigen, langerin; Langerhans cell specific c-type lectin; C-type lectin domain family 4, member K
UniProt Protein Name
C-type lectin domain family 4 member K
UniProt Gene Name
CD207
UniProt Synonym Gene Names
CLEC4K
UniProt Entry Name
CLC4K_HUMAN

NCBI Description

The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. Mutations in this gene result in Birbeck granules deficiency or loss of sugar binding activity. [provided by RefSeq, Aug 2010]

Uniprot Description

langerin: Calcium-dependent lectin displaying mannose-binding specificity. Induces the formation of Birbeck granules (BGs); is a potent regulator of membrane superimposition and zippering. Binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. Facilitates uptake of antigens and is involved in the routing and/or processing of antigen for presentation to T cells. Major receptor on primary Langerhans cells for Candida species, Saccharomyces species, and Malassezia furfur. Protects against human immunodeficiency virus-1 (HIV-1) infection. Binds to high-mannose structures present on the envelope glycoprotein which is followed by subsequent targeting of the virus to the Birbeck granules leading to its rapid degradation. Homotrimer. Exclusively expressed by Langerhans cells. Expressed in astrocytoma and malignant ependymoma, but not in normal brain tissues.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: early endosome membrane; endocytic vesicle; integral to membrane; plasma membrane

Molecular Function: mannose binding; carbohydrate binding

Biological Process: antigen processing and presentation of peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; defense response to virus

Disease: Birbeck Granule Deficiency

Research Articles on CD207

Similar Products

Product Notes

The CD207 cd207 (Catalog #AAA643828) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD207 (C-type Lectin Domain Family 4 Member K, Langerin, CLEC4K) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD207 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CD207 cd207 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTVEKEAPDA HFTVDKQNIS LWPREPPPKS GPSLVPGKTP TVRAALICLT LVLVASVLLQ AVLYPRFMGT ISDVKTNVQL LKGRVDNIST LDSEIKKNSD GMEAAGVQIQ MVNESLGYVR SQFLKLKTSV EKANAQIQIL TRSWEEVSTL NAQIPELKSD LEKASALNTK IRALQGSLEN MSKLLKRQND ILQVVSQGWK YFKGNFYYFS LIPKTWYSAE QFCVSRNSHL TSVTSESEQE FLYKTAGGLI YWIGLTKAGM EGDWSWVDDT PFNKVQSARF WIPGEPNNAG NNEHCGNIKA PSLQAWNDAP CDKTFLFICK RPYVPSEP. It is sometimes possible for the material contained within the vial of "CD207, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.